General information for g5227.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative ATP synthase subunit g, mitochondrial.
Parent gene
- The parent gene g5227 is located on chr_2: 7923312..7924236 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5227 | g5227.t1 | TSS | g5227.t1 | 7923085 | 7923085 |
| chr_2 | g5227 | g5227.t1 | isoform | g5227.t1 | 7923119 | 7923579 |
| chr_2 | g5227 | g5227.t1 | exon | g5227.t1.exon1 | 7923119 | 7923158 |
| chr_2 | g5227 | g5227.t1 | cds | g5227.t1.CDS1 | 7923119 | 7923158 |
| chr_2 | g5227 | g5227.t1 | exon | g5227.t1.exon2 | 7923320 | 7923579 |
| chr_2 | g5227 | g5227.t1 | cds | g5227.t1.CDS2 | 7923320 | 7923579 |
| chr_2 | g5227 | g5227.t1 | TTS | g5227.t1 | 7923751 | 7923751 |
Sequences
>g5227.t1 Gene=g5227 Length=300
ATGGCAGGAATCGCAAATAAAGGTTCAGCATTGGTTTCAACGCTGATGACACAAGCTAAA
CCAAGATTTGCAACATTCATGAAGTATGCAGTCGTTGAGCTTACACCACCAACACCAGCC
GATTTGCCAGCAATCAAAAATGGTATCGTTAAATTGGTATCTGGTGCAAGAACAGGTGCC
TGGAAGAATCTTACAGTATGTGAAGCATGGCTCAACACTCTTGTGACAATGGAAGTTTGC
TTCTGGTTTTATGTTGGCGAATGTATTGGAAAGAGACATCTTGTTGGATATAAAGTTTAA
>g5227.t1 Gene=g5227 Length=99
MAGIANKGSALVSTLMTQAKPRFATFMKYAVVELTPPTPADLPAIKNGIVKLVSGARTGA
WKNLTVCEAWLNTLVTMEVCFWFYVGECIGKRHLVGYKV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g5227.t1 | PANTHER | PTHR12386:SF12 | ATP SYNTHASE SUBUNIT | 4 | 99 | 0 |
| 3 | g5227.t1 | PANTHER | PTHR12386 | ATP SYNTHASE SUBUNIT | 4 | 99 | 0 |
| 4 | g5227.t1 | PIRSF | PIRSF017835 | ATP-synth_g_mitoch_animal | 1 | 99 | 0 |
| 1 | g5227.t1 | Pfam | PF04718 | Mitochondrial ATP synthase g subunit | 8 | 98 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5227/g5227.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5227.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0015986 | ATP synthesis coupled proton transport | BP |
| GO:0000276 | mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) | CC |
| GO:0015078 | proton transmembrane transporter activity | MF |
KEGG
Orthology
- This transcript has been annotated with K02140 (F-type H+-transporting ATPase subunit g)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
