General information for g525.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Tachykinin-like peptides receptor 99D.
Parent gene
- The parent gene g525 is located on chr_3: 3889296..3890448 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g525 | g525.t1 | isoform | g525.t1 | 3889296 | 3890448 |
| chr_3 | g525 | g525.t1 | exon | g525.t1.exon1 | 3889296 | 3889473 |
| chr_3 | g525 | g525.t1 | cds | g525.t1.CDS1 | 3889296 | 3889473 |
| chr_3 | g525 | g525.t1 | exon | g525.t1.exon2 | 3890199 | 3890332 |
| chr_3 | g525 | g525.t1 | cds | g525.t1.CDS2 | 3890199 | 3890332 |
| chr_3 | g525 | g525.t1 | exon | g525.t1.exon3 | 3890386 | 3890448 |
| chr_3 | g525 | g525.t1 | cds | g525.t1.CDS3 | 3890386 | 3890448 |
| chr_3 | g525 | g525.t1 | TSS | g525.t1 | NA | NA |
| chr_3 | g525 | g525.t1 | TTS | g525.t1 | NA | NA |
Sequences
>g525.t1 Gene=g525 Length=375
ATGAATCCACTCAAGCCTCGGATGGGAAAGAAATTAACACTTTGTATAGCTGGTCTAATA
TGGATTGTTGGCATCATCTCATCAAGTCCAAATTTCTTCTTTTTCACAACTGTTGAAATG
CCATATGAAGATAGAGTAGTTTGCTATGCTGAATGGCCTGATACTGATGGTGATAATCAT
AGTTTACAGGAATATATATATAATGTAGTTTTTATGTTTCTTACATATTTTGTACCAATT
GGATGTATGTCATACACATACACGCGAGTGGGTCACGAGTTGTGGGGATCACAAAGTATA
GGCGAATGCACACAAAGACAATTAGATAATATTAAGAGTAAAAGAAAGGTAAGTTGTGAT
TTATTGGTCTCATGA
>g525.t1 Gene=g525 Length=124
MNPLKPRMGKKLTLCIAGLIWIVGIISSSPNFFFFTTVEMPYEDRVVCYAEWPDTDGDNH
SLQEYIYNVVFMFLTYFVPIGCMSYTYTRVGHELWGSQSIGECTQRQLDNIKSKRKVSCD
LLVS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g525.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 1 | 123 | 2.6E-25 |
| 2 | g525.t1 | PANTHER | PTHR24238 | G-PROTEIN COUPLED RECEPTOR | 1 | 118 | 2.6E-54 |
| 3 | g525.t1 | PANTHER | PTHR24238:SF31 | TACHYKININ-LIKE PEPTIDES RECEPTOR 99D | 1 | 118 | 2.6E-54 |
| 1 | g525.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 7 | 100 | 2.0E-9 |
| 11 | g525.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 28 | - |
| 12 | g525.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 11 | - |
| 13 | g525.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 12 | 23 | - |
| 15 | g525.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 24 | 28 | - |
| 10 | g525.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 29 | 64 | - |
| 14 | g525.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 87 | - |
| 9 | g525.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 88 | 124 | - |
| 8 | g525.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 1 | 124 | 11.184 |
| 6 | g525.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 2 | 103 | 1.19E-13 |
| 5 | g525.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 34 | - |
| 4 | g525.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 87 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g525/g525.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g525.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed