General information for g527.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g527 is located on chr_3: 3904182..3904890 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g527 | g527.t1 | isoform | g527.t1 | 3904182 | 3904890 |
| chr_3 | g527 | g527.t1 | exon | g527.t1.exon1 | 3904182 | 3904360 |
| chr_3 | g527 | g527.t1 | cds | g527.t1.CDS1 | 3904182 | 3904360 |
| chr_3 | g527 | g527.t1 | exon | g527.t1.exon2 | 3904788 | 3904890 |
| chr_3 | g527 | g527.t1 | cds | g527.t1.CDS2 | 3904788 | 3904890 |
| chr_3 | g527 | g527.t1 | TSS | g527.t1 | NA | NA |
| chr_3 | g527 | g527.t1 | TTS | g527.t1 | NA | NA |
Sequences
>g527.t1 Gene=g527 Length=282
ATGTTTGCTGGCATGATTGTGGTCGCAACAGTTGGCAATCTTGCTGTGATATGGATCGTG
TTGGCTCACAAGCGCATGAGAACGGTTACAAATTATTTTATAGTGAATTTATCCATAGCC
GATGCAATGGTATCAACGCTAAATACCGCACTCAACTTTGTGTACATGCTAAACTCCAAT
TGGCCTTTTGGAACGCTGTTCTGTAAAATATCACAATTTGTAGCAAATACGAGTATATGT
GCTTCAGTCTTCACATTAATGGCTATCGCTATTGATAGGTAA
>g527.t1 Gene=g527 Length=93
MFAGMIVVATVGNLAVIWIVLAHKRMRTVTNYFIVNLSIADAMVSTLNTALNFVYMLNSN
WPFGTLFCKISQFVANTSICASVFTLMAIAIDR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g527.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 1 | 93 | 1.1E-32 |
| 2 | g527.t1 | PANTHER | PTHR24238 | G-PROTEIN COUPLED RECEPTOR | 1 | 93 | 2.9E-43 |
| 3 | g527.t1 | PANTHER | PTHR24238:SF31 | TACHYKININ-LIKE PEPTIDES RECEPTOR 99D | 1 | 93 | 2.9E-43 |
| 7 | g527.t1 | PRINTS | PR01012 | Neuropeptide Y receptor signature | 22 | 34 | 4.3E-6 |
| 4 | g527.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 30 | 51 | 2.2E-9 |
| 6 | g527.t1 | PRINTS | PR01012 | Neuropeptide Y receptor signature | 52 | 64 | 4.3E-6 |
| 5 | g527.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 75 | 93 | 2.2E-9 |
| 8 | g527.t1 | PRINTS | PR01012 | Neuropeptide Y receptor signature | 75 | 90 | 4.3E-6 |
| 1 | g527.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 12 | 93 | 1.6E-23 |
| 13 | g527.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 17 | g527.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 22 | - |
| 12 | g527.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 23 | 33 | - |
| 16 | g527.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 58 | - |
| 14 | g527.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 59 | 69 | - |
| 15 | g527.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 70 | 91 | - |
| 11 | g527.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 92 | 93 | - |
| 21 | g527.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 12 | 93 | 21.736 |
| 9 | g527.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 2 | 93 | 5.13E-25 |
| 20 | g527.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 5 | 22 | - |
| 19 | g527.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 35 | 57 | - |
| 18 | g527.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 72 | 91 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g527/g527.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g527.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0004983 | neuropeptide Y receptor activity | MF |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed