| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5318 | g5318.t10 | TSS | g5318.t10 | 8706373 | 8706373 |
| chr_2 | g5318 | g5318.t10 | isoform | g5318.t10 | 8706418 | 8707617 |
| chr_2 | g5318 | g5318.t10 | exon | g5318.t10.exon1 | 8706418 | 8706478 |
| chr_2 | g5318 | g5318.t10 | cds | g5318.t10.CDS1 | 8706418 | 8706478 |
| chr_2 | g5318 | g5318.t10 | exon | g5318.t10.exon2 | 8706532 | 8706683 |
| chr_2 | g5318 | g5318.t10 | cds | g5318.t10.CDS2 | 8706532 | 8706683 |
| chr_2 | g5318 | g5318.t10 | exon | g5318.t10.exon3 | 8706747 | 8706942 |
| chr_2 | g5318 | g5318.t10 | cds | g5318.t10.CDS3 | 8706747 | 8706942 |
| chr_2 | g5318 | g5318.t10 | exon | g5318.t10.exon4 | 8707130 | 8707309 |
| chr_2 | g5318 | g5318.t10 | cds | g5318.t10.CDS4 | 8707130 | 8707179 |
| chr_2 | g5318 | g5318.t10 | exon | g5318.t10.exon5 | 8707384 | 8707617 |
| chr_2 | g5318 | g5318.t10 | TTS | g5318.t10 | 8707663 | 8707663 |
>g5318.t10 Gene=g5318 Length=823
ATGGAAACATCGAGTGTGAGTGCATTTAAGATTGCAGTTGACTTTGTGCTATTAGCAATA
CCTGGCCTCATTGCTTTAATTTTGAATCTCTTTGTGACTCCATTTCAACGAAATTTCTTC
TGTAATGATTTGTCAATTATGTATCCATATAAACCTGATACAATCACTACATTGCAACTT
GCTCTTGTTGGTGTAATTGTGAGCGTCGTATTTGTATTTATCGTGGAATTAATTCATAAG
TTTAATAATTCATATAAATATGATGATGACGATGATAAAGAGAGCAAAATTCTGTATAAA
TGGAACATTTCACCATTCATTCAGAATTTATATCAGTATATTGGCCTCCTGTTGTTTGGA
ATATCAATCAATCAGTTTATAACTGATGGCACAAAATTTGTTGTTGGACGTCTGTCGTCC
AGTTTTATCAAATGGATTAACATGCAAAGACTTAGATAACTGGAACACTTACATCTCTGA
CTACACTTGCACTAATCAGGATGTTAGTGATTGGACTCTCACAAATGCTCGAATTTCATT
TCCTTCTGGTCATGCGAGTTTCTCATTCTATTGTTCATTTTTCTGTGCATTTTATATTCA
ATCGCGAATGAAATTTGGAGGGTCAAAGCTTTTGAAACATTTTATTCAATTAGTGTTTGT
CACAGCTGCTCTTTATACTGGCTTATCACGAATTACGGACTATAAGCATCATCCAACTGA
CGTAATAGCTGGCAGTATTTTAGGAATTCTTATTGCATTTGTTGTTTGCTTTTATTTTTC
TGATTTATTTAAGAGAAAAATTAATAATGTCTTACCGAGATGA
>g5318.t10 Gene=g5318 Length=152
METSSVSAFKIAVDFVLLAIPGLIALILNLFVTPFQRNFFCNDLSIMYPYKPDTITTLQL
ALVGVIVSVVFVFIVELIHKFNNSYKYDDDDDKESKILYKWNISPFIQNLYQYIGLLLFG
ISINQFITDGTKFVVGRLSSSFIKWINMQRLR
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g5318.t10 | PANTHER | PTHR10165 | LIPID PHOSPHATE PHOSPHATASE | 9 | 144 | 5.5E-21 |
| 2 | g5318.t10 | PANTHER | PTHR10165:SF173 | FI04477P-RELATED | 9 | 144 | 5.5E-21 |
| 5 | g5318.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 11 | - |
| 10 | g5318.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 12 | 35 | - |
| 8 | g5318.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 36 | 54 | - |
| 9 | g5318.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 78 | - |
| 6 | g5318.t10 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 79 | 109 | - |
| 11 | g5318.t10 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 110 | 127 | - |
| 7 | g5318.t10 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 128 | 152 | - |
| 4 | g5318.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 13 | 35 | - |
| 3 | g5318.t10 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 55 | 77 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5318/g5318.t10; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5318.t10.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0042577 | lipid phosphatase activity | MF |
| GO:0006644 | phospholipid metabolic process | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed