| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5451 | g5451.t1 | TTS | g5451.t1 | 9666665 | 9666665 |
| chr_2 | g5451 | g5451.t1 | isoform | g5451.t1 | 9666726 | 9667104 |
| chr_2 | g5451 | g5451.t1 | exon | g5451.t1.exon1 | 9666726 | 9666800 |
| chr_2 | g5451 | g5451.t1 | cds | g5451.t1.CDS1 | 9666726 | 9666800 |
| chr_2 | g5451 | g5451.t1 | exon | g5451.t1.exon2 | 9666882 | 9667019 |
| chr_2 | g5451 | g5451.t1 | cds | g5451.t1.CDS2 | 9666882 | 9667019 |
| chr_2 | g5451 | g5451.t1 | exon | g5451.t1.exon3 | 9667093 | 9667104 |
| chr_2 | g5451 | g5451.t1 | cds | g5451.t1.CDS3 | 9667093 | 9667104 |
| chr_2 | g5451 | g5451.t1 | TSS | g5451.t1 | 9667233 | 9667233 |
>g5451.t1 Gene=g5451 Length=225
ATGGATAGCCAACCAATGAGTGATGAACGTTTAATTGATATCGTTGATAATGAATGGCGT
AATGATAAGCTTCCAGATGAAGATATTCAATTGCCACTTGACAAGCTACCAGACCCAGAA
GATTCTGAAAATCAAACGATGAAAGAAGTTGAAGATAAGTGGTTGGATCTTGCTATTATT
AATCGTCACTCAACAGACGATACATTGAATATCAGCAATCCATAA
>g5451.t1 Gene=g5451 Length=74
MDSQPMSDERLIDIVDNEWRNDKLPDEDIQLPLDKLPDPEDSENQTMKEVEDKWLDLAII
NRHSTDDTLNISNP
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g5451.t1 | PANTHER | PTHR28672 | ANAPHASE-PROMOTING COMPLEX SUBUNIT 13 | 1 | 65 | 0.0e+00 |
| 1 | g5451.t1 | Pfam | PF05839 | Apc13p protein | 1 | 53 | 2.9e-05 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5451/g5451.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5451.t1.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005680 | anaphase-promoting complex | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.