General information for g5500.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Dopamine receptor 1.
Parent gene
- The parent gene g5500 is located on chr_2: 9911889..9914930 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5500 | g5500.t1 | TSS | g5500.t1 | 9911124 | 9911124 |
| chr_2 | g5500 | g5500.t1 | isoform | g5500.t1 | 9911889 | 9914930 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon1 | 9911889 | 9911991 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS1 | 9911889 | 9911991 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon2 | 9912131 | 9912310 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS2 | 9912131 | 9912310 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon3 | 9913162 | 9913291 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS3 | 9913162 | 9913291 |
| chr_2 | g5500 | g5500.t1 | TTS | g5500.t1 | 9913512 | 9913512 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon4 | 9913573 | 9913821 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS4 | 9913573 | 9913821 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon5 | 9914069 | 9914313 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS5 | 9914069 | 9914313 |
| chr_2 | g5500 | g5500.t1 | exon | g5500.t1.exon6 | 9914608 | 9914930 |
| chr_2 | g5500 | g5500.t1 | cds | g5500.t1.CDS6 | 9914608 | 9914930 |
Sequences
>g5500.t1 Gene=g5500 Length=1230
ATGAGCAGCAGCACCAACAGTAACAGTAACAACAATAATACTTGGTTCTCACCAAACGAA
AACACATCAAATGTGATGGAGAAAATAATCATGGCAATGACGGCCACGTTTCTTGCAACC
ATCATATTTCTAGCAGCAACTGGAAACATTCTTGTTTGTTTAGCCATTGCAACAGAACGT
AGCCTTCGACGAATAGGAAACTTATTTCTTGCCTCACTTGCAATAGCTGATTTATTTGTA
TCCATTTTAGTTATGACATTTGCTAGTGTAAATGATATTTTAGGATATTGGATTTTTGGT
GCTGAATTTTGCGATACTTGGATAGCGTTTGATGTGATGTGCTCAACATCGTCAATTTTA
AATTTATGTGCGATTTCACTAGATCGCTATATTCACATAAAAGATCCCCTTAGATATACA
AGATGGGTGACGAGACGTGTTGCAATTATAACGATAGCAGCAATTTGGATGGTGGCTGCT
TTTGTGTCTTTTGTTCCCATCTCACTAGGCCTGCATCGTCCCAATGAGCCATTAATCATT
GAGATTCGAAATGGCATTGAATATCCAACATGTGCACTTGATCTTACTCCAACTTATGCT
GTAGTATCGAGCTGTATTAGTTTTTATCTTCCTTGTGCTGTACTTGTTGGAATTTATTGC
AGGTTATATTGTTATGCACAGAAGCATGTCCGGTCAATTCGTGCTGTCACAAGAGCAAAT
ACAGATGGATCACAGCAGCAATATCATCGCAATACAACATTGAATCGTCGAAACGGAAAT
AGCTGCAGCAATACTCCACTTGGTAAAAAGAAAAAATCTAAACGTTCACCCCATCAATTA
GCAGCCTATCACACATCAGATAGAAAAGCAGCTGTCACAGTGGGTGTCATAATGGGTGTC
TTTCTTGTATGCTGGATGCCTTTCTTTTGTGTCAACATTGTGGCAGCATTTTGTAAGACA
TGCATCAATGAGACAACTTTCAAGATACTTTCATGGCTTGGCTACTCAAATTCCTGCTTT
AATCCTATTATTTACTCAATTTTCAACACGGAATTCCGTAAAGCATTCAAGCGCATTCTT
TTGAAACGACAACTACCAAAGCTATTATGCTGTGGCACCTTTCAGAATGAATACTACGTA
AATAGTTCAAATGACAGCAAATTCATCACAAACTACGATGCCAAGTTCTTGCATTCAACA
ACAGATGTTGAGCAGCTGTCGGCCATTTAA
>g5500.t1 Gene=g5500 Length=409
MSSSTNSNSNNNNTWFSPNENTSNVMEKIIMAMTATFLATIIFLAATGNILVCLAIATER
SLRRIGNLFLASLAIADLFVSILVMTFASVNDILGYWIFGAEFCDTWIAFDVMCSTSSIL
NLCAISLDRYIHIKDPLRYTRWVTRRVAIITIAAIWMVAAFVSFVPISLGLHRPNEPLII
EIRNGIEYPTCALDLTPTYAVVSSCISFYLPCAVLVGIYCRLYCYAQKHVRSIRAVTRAN
TDGSQQQYHRNTTLNRRNGNSCSNTPLGKKKKSKRSPHQLAAYHTSDRKAAVTVGVIMGV
FLVCWMPFFCVNIVAAFCKTCINETTFKILSWLGYSNSCFNPIIYSIFNTEFRKAFKRIL
LKRQLPKLLCCGTFQNEYYVNSSNDSKFITNYDAKFLHSTTDVEQLSAI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 32 | g5500.t1 | CDD | cd15065 | 7tmA_Ap5-HTB1-like | 36 | 356 | 3.34099E-160 |
| 16 | g5500.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 22 | 367 | 4.0E-89 |
| 2 | g5500.t1 | PANTHER | PTHR24247:SF238 | DOPAMINE RECEPTOR 1 | 3 | 375 | 1.4E-118 |
| 3 | g5500.t1 | PANTHER | PTHR24247 | 5-HYDROXYTRYPTAMINE RECEPTOR | 3 | 375 | 1.4E-118 |
| 7 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 33 | 57 | 1.0E-47 |
| 12 | g5500.t1 | PRINTS | PR00242 | Dopamine receptor signature | 53 | 63 | 9.0E-8 |
| 6 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 66 | 87 | 1.0E-47 |
| 4 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 111 | 133 | 1.0E-47 |
| 11 | g5500.t1 | PRINTS | PR00242 | Dopamine receptor signature | 132 | 140 | 9.0E-8 |
| 10 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 147 | 168 | 1.0E-47 |
| 9 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 200 | 223 | 1.0E-47 |
| 8 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 290 | 314 | 1.0E-47 |
| 13 | g5500.t1 | PRINTS | PR00242 | Dopamine receptor signature | 322 | 333 | 9.0E-8 |
| 5 | g5500.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 327 | 353 | 1.0E-47 |
| 14 | g5500.t1 | PRINTS | PR00242 | Dopamine receptor signature | 347 | 361 | 9.0E-8 |
| 1 | g5500.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 48 | 345 | 1.1E-70 |
| 24 | g5500.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 28 | - |
| 29 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 56 | - |
| 20 | g5500.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 57 | 67 | - |
| 31 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 87 | - |
| 23 | g5500.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 88 | 106 | - |
| 27 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 107 | 127 | - |
| 19 | g5500.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 128 | 146 | - |
| 28 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 147 | 169 | - |
| 21 | g5500.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 170 | 198 | - |
| 26 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 199 | 224 | - |
| 18 | g5500.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 225 | 289 | - |
| 30 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 290 | 317 | - |
| 22 | g5500.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 318 | 328 | - |
| 25 | g5500.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 329 | 348 | - |
| 17 | g5500.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 349 | 409 | - |
| 41 | g5500.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 117 | 133 | - |
| 42 | g5500.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 48 | 345 | 43.963 |
| 40 | g5500.t1 | SMART | SM01381 | 7TM_GPCR_Srsx_2 | 42 | 360 | 1.4E-6 |
| 15 | g5500.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 8 | 366 | 5.04E-71 |
| 39 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 52 | - |
| 34 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 87 | - |
| 38 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 107 | 126 | - |
| 36 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 147 | 169 | - |
| 35 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 198 | 220 | - |
| 37 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 292 | 314 | - |
| 33 | g5500.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 329 | 348 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5500/g5500.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5500.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04144 (dopamine receptor D1)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed