| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5783 | g5783.t2 | TSS | g5783.t2 | 11920795 | 11920795 |
| chr_2 | g5783 | g5783.t2 | isoform | g5783.t2 | 11920828 | 11921393 |
| chr_2 | g5783 | g5783.t2 | exon | g5783.t2.exon1 | 11920828 | 11920930 |
| chr_2 | g5783 | g5783.t2 | cds | g5783.t2.CDS1 | 11920828 | 11920930 |
| chr_2 | g5783 | g5783.t2 | exon | g5783.t2.exon2 | 11921110 | 11921312 |
| chr_2 | g5783 | g5783.t2 | cds | g5783.t2.CDS2 | 11921110 | 11921312 |
| chr_2 | g5783 | g5783.t2 | exon | g5783.t2.exon3 | 11921376 | 11921393 |
| chr_2 | g5783 | g5783.t2 | cds | g5783.t2.CDS3 | 11921376 | 11921393 |
| chr_2 | g5783 | g5783.t2 | TTS | g5783.t2 | NA | NA |
>g5783.t2 Gene=g5783 Length=324
ATGAAGAGGATTTTAAGTTTAGCGAATTTAAAATTATTAAATAAATGTCATTATAATCCA
GTGTATCAGAAATCTTTTGATATAAAAAGGCATGCTAGTAAAGATAATATTTGTAGGTTT
ATTCATGTATCCAGCACTAGTTTACAAAGAAAGGATTATTATAGCGTTTTAGGAGTCAAT
AAATCGGCATCAGCAAAGGATATTAAAAAGGCGTATTATGAGTTAGCTAAAAAATATCAT
CCAGATACCAACAAAGATGATCCAAATGCAAGTAAAAAATTTCAAGAAGTTTCGGAAGCA
TACGAGGTGCTGAGTGATGATACA
>g5783.t2 Gene=g5783 Length=108
MKRILSLANLKLLNKCHYNPVYQKSFDIKRHASKDNICRFIHVSSTSLQRKDYYSVLGVN
KSASAKDIKKAYYELAKKYHPDTNKDDPNASKKFQEVSEAYEVLSDDT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g5783.t2 | CDD | cd06257 | DnaJ | 52 | 106 | 0.000 |
| 8 | g5783.t2 | Gene3D | G3DSA:1.10.287.110 | - | 39 | 108 | 0.000 |
| 2 | g5783.t2 | PANTHER | PTHR44145 | DNAJ HOMOLOG SUBFAMILY A MEMBER 3, MITOCHONDRIAL | 38 | 107 | 0.000 |
| 3 | g5783.t2 | PANTHER | PTHR44145:SF3 | DNAJ HOMOLOG SUBFAMILY A MEMBER 3, MITOCHONDRIAL | 38 | 107 | 0.000 |
| 4 | g5783.t2 | PRINTS | PR00625 | DnaJ domain signature | 54 | 72 | 0.000 |
| 5 | g5783.t2 | PRINTS | PR00625 | DnaJ domain signature | 72 | 87 | 0.000 |
| 6 | g5783.t2 | PRINTS | PR00625 | DnaJ domain signature | 89 | 108 | 0.000 |
| 1 | g5783.t2 | Pfam | PF00226 | DnaJ domain | 52 | 107 | 0.000 |
| 11 | g5783.t2 | ProSiteProfiles | PS50076 | dnaJ domain profile. | 52 | 108 | 19.794 |
| 10 | g5783.t2 | SMART | SM00271 | dnaj_3 | 51 | 108 | 0.000 |
| 7 | g5783.t2 | SUPERFAMILY | SSF46565 | Chaperone J-domain | 48 | 107 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5783/g5783.t2; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5783.t2.fa.iupred3.txt does not exist
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.