Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g5786 g5786.t1 TTS g5786.t1 11936936 11936936
chr_2 g5786 g5786.t1 isoform g5786.t1 11937230 11937661
chr_2 g5786 g5786.t1 exon g5786.t1.exon1 11937230 11937331
chr_2 g5786 g5786.t1 cds g5786.t1.CDS1 11937230 11937331
chr_2 g5786 g5786.t1 exon g5786.t1.exon2 11937399 11937518
chr_2 g5786 g5786.t1 cds g5786.t1.CDS2 11937399 11937518
chr_2 g5786 g5786.t1 exon g5786.t1.exon3 11937593 11937661
chr_2 g5786 g5786.t1 cds g5786.t1.CDS3 11937593 11937661
chr_2 g5786 g5786.t1 TSS g5786.t1 11937754 11937754

Sequences

>g5786.t1 Gene=g5786 Length=291
ATGAGATTCTGTGGTCCTAAATTATCGCTTTGCGGTCTGATCATCTCAGTATGGGGTATT
ATTCAATTGCTGCTTATGGGTGTCTTTTACTACATTCATAGTGTGGCGCTTATTGAAGAT
TTGCCAATTGAGGAGCATTATCACACTGCAGAAGAGTTTTATGCTGCTGCAGACCGAGCA
TATAGACAAAATGCACTCAACTGTTGGATTGCTGCTTTGATTTATGTCGTCACTTTAGCA
ATTTCTACTTGGCAATTCTATGCTAATCAACGTGCAAGCTCTGTAAATTAA

>g5786.t1 Gene=g5786 Length=96
MRFCGPKLSLCGLIISVWGIIQLLLMGVFYYIHSVALIEDLPIEEHYHTAEEFYAAADRA
YRQNALNCWIAALIYVVTLAISTWQFYANQRASSVN

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g5786.t1 PANTHER PTHR31733 RIBONUCLEASE KAPPA 2 94 2.4E-26
2 g5786.t1 PANTHER PTHR31733:SF1 RIBONUCLEASE KAPPA 2 94 2.4E-26
5 g5786.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 1 11 -
8 g5786.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 12 32 -
7 g5786.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 33 68 -
9 g5786.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 69 87 -
6 g5786.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 88 96 -
4 g5786.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 10 32 -
3 g5786.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 66 88 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

Data is missing for g5786/g5786.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5786.t1.fa.iupred3.txt does not exist

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004521 endoribonuclease activity MF
GO:0090305 nucleic acid phosphodiester bond hydrolysis BP

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values