| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5813 | g5813.t3 | isoform | g5813.t3 | 12041880 | 12042289 |
| chr_2 | g5813 | g5813.t3 | exon | g5813.t3.exon1 | 12041880 | 12042289 |
| chr_2 | g5813 | g5813.t3 | cds | g5813.t3.CDS1 | 12041933 | 12042289 |
| chr_2 | g5813 | g5813.t3 | TSS | g5813.t3 | 12042304 | 12042304 |
| chr_2 | g5813 | g5813.t3 | TTS | g5813.t3 | NA | NA |
>g5813.t3 Gene=g5813 Length=410
ATGACAAACAACGAAATTCAATGGGATTGGAAAGAATTTTGTGAGACTGGTCTCAATGTT
TCAACAAATTCAAGTTCGATAACTCCCTGTGGACAGCAAATTTATATTCATCTGCCAACT
TTCTCACTTTTGGCAATAATTAGTTCATATAATTATGGAAAACTCATTGATCCAGTTTTG
AGGAATAATACTCAAAAATGGTGTCTTAGCATAAGAGCGCTATTAGTCATAGTGTTAGCA
ATTTTACCTCTTATCAAACTACTCACTGAGATGCAAAATGGTGAAAAAATTTGGCCGGTT
GATGTTTTATTAGCATGCACTGAAGCTTTATGCTGGACTATTCATTTTGGTGAGTAATTA
AACTATAAATTATGATGAAATGACAAATAAAAATAAGTAATTTCCACAGC
>g5813.t3 Gene=g5813 Length=118
MTNNEIQWDWKEFCETGLNVSTNSSSITPCGQQIYIHLPTFSLLAIISSYNYGKLIDPVL
RNNTQKWCLSIRALLVIVLAILPLIKLLTEMQNGEKIWPVDVLLACTEALCWTIHFGE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g5813.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 33 | - |
| 9 | g5813.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 55 | - |
| 3 | g5813.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 56 | 66 | - |
| 8 | g5813.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 85 | - |
| 6 | g5813.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 86 | 96 | - |
| 7 | g5813.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 117 | - |
| 4 | g5813.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 118 | 118 | - |
| 2 | g5813.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 34 | 56 | - |
| 1 | g5813.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 68 | 85 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5813/g5813.t3; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5813.t3.fa.iupred3.txt does not exist
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed