General information for g584.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Pyrokinin-1 receptor.
Parent gene
- The parent gene g584 is located on chr_3: 4325415..4328972 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g584 | g584.t1 | isoform | g584.t1 | 4325415 | 4328972 |
| chr_3 | g584 | g584.t1 | exon | g584.t1.exon1 | 4325415 | 4325838 |
| chr_3 | g584 | g584.t1 | cds | g584.t1.CDS1 | 4325415 | 4325838 |
| chr_3 | g584 | g584.t1 | exon | g584.t1.exon2 | 4328659 | 4328824 |
| chr_3 | g584 | g584.t1 | cds | g584.t1.CDS2 | 4328659 | 4328824 |
| chr_3 | g584 | g584.t1 | exon | g584.t1.exon3 | 4328876 | 4328972 |
| chr_3 | g584 | g584.t1 | cds | g584.t1.CDS3 | 4328876 | 4328972 |
| chr_3 | g584 | g584.t1 | TSS | g584.t1 | NA | NA |
| chr_3 | g584 | g584.t1 | TTS | g584.t1 | NA | NA |
Sequences
>g584.t1 Gene=g584 Length=687
ATGATGGACTATGTAATGAGTATGACCACATCAGCATCTTATATAGACGACGACAGTGCA
AGTTTAGTGTTAGTTGATCAAAATAGTTTTGCATTAAGTGAATTAAATAATCAATTAAAT
AATAATAACAACTTTTCATCGATGGATGGCGAAGAAATTCTTTTTGCACTCACAACTGAG
GCGCTAAATAATTTGACACTTTCAACAATAACAAATAGTGCAGTTGTAAAAAATGAAGTA
GGCTACAGAGACTCATTGTCAATAATTGTCCCAATAACAATTTGCTATTTGATAATCTTT
ATTGCGGGCGTGCTTGGAAATGTAATCACGTGTGTTGTGATTGCAAAAAACAAAACCATG
CACACAGCTACAAATTACTATCTTTTCAATTTGGCAGTTTCTGACTTTCTCGTTCTCATT
TTTGGAATGCCTCATGACATGTACAATATTTGGTATCCTAATTCGTATCCATTTAGCGAA
ATTGTCTGCATTTTACAAGGACTTTTCTCAGAAACATCTTTAAACGCTACAATTTTAACA
ATTACTTCATTTACCTGTGAAAGATACATCGCTATATGCCATCCATTCAGACATTTTATT
TTACTTGCATCAGCGGAATTGAGAAAAAATCTTTTGCTCAGCCGCTTTCTCATTCTTCTT
CAAAGAGTCATTAGTAATGATAAATGA
>g584.t1 Gene=g584 Length=228
MMDYVMSMTTSASYIDDDSASLVLVDQNSFALSELNNQLNNNNNFSSMDGEEILFALTTE
ALNNLTLSTITNSAVVKNEVGYRDSLSIIVPITICYLIIFIAGVLGNVITCVVIAKNKTM
HTATNYYLFNLAVSDFLVLIFGMPHDMYNIWYPNSYPFSEIVCILQGLFSETSLNATILT
ITSFTCERYIAICHPFRHFILLASAELRKNLLLSRFLILLQRVISNDK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g584.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 74 | 220 | 3.9E-37 |
| 2 | g584.t1 | PANTHER | PTHR24243 | G-PROTEIN COUPLED RECEPTOR | 54 | 198 | 3.3E-68 |
| 3 | g584.t1 | PANTHER | PTHR24243:SF209 | PYROKININ 2 RECEPTOR 1-RELATED | 54 | 198 | 3.3E-68 |
| 4 | g584.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 91 | 115 | 1.7E-17 |
| 5 | g584.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 124 | 145 | 1.7E-17 |
| 6 | g584.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 170 | 192 | 1.7E-17 |
| 1 | g584.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 106 | 199 | 2.0E-20 |
| 10 | g584.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 87 | - |
| 12 | g584.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 88 | 114 | - |
| 9 | g584.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 115 | 125 | - |
| 13 | g584.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 143 | - |
| 11 | g584.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 144 | 228 | - |
| 16 | g584.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 176 | 192 | - |
| 17 | g584.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 106 | 228 | 19.569 |
| 7 | g584.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 74 | 199 | 5.49E-30 |
| 14 | g584.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 114 | - |
| 15 | g584.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 148 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g584/g584.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g584.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed