General information for g5860.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Equilibrative nucleoside transporter 1.
Parent gene
- The parent gene g5860 is located on chr_2: 12441590..12443686 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5860 | g5860.t1 | TTS | g5860.t1 | 12438984 | 12438984 |
| chr_2 | g5860 | g5860.t1 | isoform | g5860.t1 | 12439147 | 12441777 |
| chr_2 | g5860 | g5860.t1 | exon | g5860.t1.exon1 | 12439147 | 12439261 |
| chr_2 | g5860 | g5860.t1 | cds | g5860.t1.CDS1 | 12439147 | 12439261 |
| chr_2 | g5860 | g5860.t1 | exon | g5860.t1.exon2 | 12439321 | 12440241 |
| chr_2 | g5860 | g5860.t1 | cds | g5860.t1.CDS2 | 12439321 | 12440241 |
| chr_2 | g5860 | g5860.t1 | exon | g5860.t1.exon3 | 12440303 | 12440491 |
| chr_2 | g5860 | g5860.t1 | cds | g5860.t1.CDS3 | 12440303 | 12440491 |
| chr_2 | g5860 | g5860.t1 | exon | g5860.t1.exon4 | 12441551 | 12441777 |
| chr_2 | g5860 | g5860.t1 | cds | g5860.t1.CDS4 | 12441551 | 12441777 |
| chr_2 | g5860 | g5860.t1 | TSS | g5860.t1 | 12441953 | 12441953 |
Sequences
>g5860.t1 Gene=g5860 Length=1452
ATGATTAATTCACCATCGCGTAGTCCACTTTTAAACAATCCTCAAGATGAAGTCTCAAGT
GAGGATGAATCTCAAGAAAATCTGCATGCAACAATAGTTGAGACTAATACTTATATTGCA
ACTTCTGCCCGCTCACAAAATACAGGTGCTAAAGAATACACCCGACTCACTTCAGTTCCA
GTCGATCGCTACAACTTTGCTTTCCTTGTCTTTTATTTTCTTGGGATGGTTACAATGCTT
CCATGGAATTTCTTTATAACAGCTGAAGATTACTGGCAATATAAATTTAGAAATTTATCA
AGTAATGATTCATCTGTTCTAACTCCAAGGCAAATAGAATTTCAACCAGATATCGCCATA
TGTTCTTCAATTCCAACCACGATATTTCTCGTGCTCAATGCATTCTTTAGTCACAAAATT
TCACTGAAACTTCGTATGGTTGGCTCAATGATAGTGGTTTTAGTTCTCTTCACAATCACA
ACTGCTTTTGTGGAAATTAACACAGATGATTATCAAGATTTGTTTTTTGAATTTACACTG
ACAATAGTTTTCATCATCAACATTTTTAGTGCAATATTGAATGGTGGTTTATTTGGAATT
GCAGGAATGTTTAGCAGCAAATATATTACGGCAGTAATTGGCGGACAGGCACTTGGAGGA
GTTTTTACAGCTCTAGCTGAAGTAATTTCAATAACATTCGCAACTGATCCGATAATTAGC
GCTTTGGTTTACTTCCTCGTTGGAACAGCTATGCTTATTGCAGCTTTAGTTCTTTATACA
ATGTTATCACGATCTGTTTTCTTCAAATATCACATAAATCAATCACATATAAAAGCTAAT
ACGCTATCAATAAATGCAGATCACAATCAAACAGCAATCACAACGGTTGCAAGCAATAGT
CGAAATTATTTACAACCTGATTGGAAGAAAGTTTGTTCAAAAATATGGATGCATGGTTCA
GGAGCATTGCTTTGCATGATAACAACATTGAGTGTTTATCCTGCAATAACTGTGCTTGTT
AAACCAGTACATCATGGTGGAAAATGGAACGAAGTTTATTTCTTGCCAGTTTTGAATTAT
CTTCTCTTTAATAGTGGCGATTACACTGGCAGAATTGTCTCAGGTTGGCTCAAATGGCCA
GCAAACCGACCAAAAATTGTTATGTTATTGACCGTTTTGAGAATTGGCTTTGTACCGGCT
TTGTTGTTATGTAATATTACGCAAAAACATCCATTGCCTGTTCTTTTTCATTCCGATGAA
ATTTTTATCGCATTAATGGCTTGTTTTGCATTTACAAATGGTTATATTGCAAATATCAGC
TGCATCTATGCACCAACAGTTGTTGAAGAACATGAAAAAGAAATGACATCGAGCTTAATG
GCCGCTTTTATGGGAATTGGTTTAACAATAGGATCTGCAATAAGTTTTGTACTTATTCAG
TTTGTGTCTTAA
>g5860.t1 Gene=g5860 Length=483
MINSPSRSPLLNNPQDEVSSEDESQENLHATIVETNTYIATSARSQNTGAKEYTRLTSVP
VDRYNFAFLVFYFLGMVTMLPWNFFITAEDYWQYKFRNLSSNDSSVLTPRQIEFQPDIAI
CSSIPTTIFLVLNAFFSHKISLKLRMVGSMIVVLVLFTITTAFVEINTDDYQDLFFEFTL
TIVFIINIFSAILNGGLFGIAGMFSSKYITAVIGGQALGGVFTALAEVISITFATDPIIS
ALVYFLVGTAMLIAALVLYTMLSRSVFFKYHINQSHIKANTLSINADHNQTAITTVASNS
RNYLQPDWKKVCSKIWMHGSGALLCMITTLSVYPAITVLVKPVHHGGKWNEVYFLPVLNY
LLFNSGDYTGRIVSGWLKWPANRPKIVMLLTVLRIGFVPALLLCNITQKHPLPVLFHSDE
IFIALMACFAFTNGYIANISCIYAPTVVEEHEKEMTSSLMAAFMGIGLTIGSAISFVLIQ
FVS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 48 | g5860.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 18 | - |
| 49 | g5860.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 25 | - |
| 2 | g5860.t1 | PANTHER | PTHR10332 | EQUILIBRATIVE NUCLEOSIDE TRANSPORTER | 52 | 480 | 6.2E-89 |
| 3 | g5860.t1 | PANTHER | PTHR10332:SF10 | EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 1, ISOFORM A | 52 | 480 | 6.2E-89 |
| 36 | g5860.t1 | PIRSF | PIRSF016379 | ENT | 18 | 483 | 3.0E-104 |
| 8 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 186 | 208 | 3.3E-42 |
| 4 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 214 | 234 | 3.3E-42 |
| 7 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 326 | 343 | 3.3E-42 |
| 6 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 359 | 380 | 3.3E-42 |
| 5 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 387 | 404 | 3.3E-42 |
| 10 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 419 | 435 | 3.3E-42 |
| 9 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 438 | 454 | 3.3E-42 |
| 11 | g5860.t1 | PRINTS | PR01130 | Delayed-early response protein/equilibrative nucleoside transporter signature | 456 | 480 | 3.3E-42 |
| 1 | g5860.t1 | Pfam | PF01733 | Nucleoside transporter | 182 | 478 | 4.4E-65 |
| 17 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 63 | - |
| 33 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 85 | - |
| 22 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 86 | 113 | - |
| 34 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 114 | 135 | - |
| 13 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 136 | 146 | - |
| 32 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 147 | 166 | - |
| 24 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 167 | 177 | - |
| 35 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 178 | 201 | - |
| 15 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 202 | 207 | - |
| 27 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 208 | 235 | - |
| 20 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 236 | 240 | - |
| 25 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 241 | 262 | - |
| 18 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 263 | 314 | - |
| 28 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 315 | 340 | - |
| 21 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 341 | 351 | - |
| 31 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 352 | 374 | - |
| 16 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 375 | 385 | - |
| 29 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 386 | 403 | - |
| 19 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 404 | 422 | - |
| 26 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 423 | 447 | - |
| 14 | g5860.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 448 | 458 | - |
| 30 | g5860.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 459 | 482 | - |
| 23 | g5860.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 483 | 483 | - |
| 12 | g5860.t1 | SUPERFAMILY | SSF103473 | MFS general substrate transporter | 65 | 481 | 2.88E-11 |
| 43 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 86 | - |
| 46 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 118 | 137 | - |
| 47 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 144 | 166 | - |
| 44 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 176 | 198 | - |
| 45 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 211 | 233 | - |
| 40 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 238 | 260 | - |
| 38 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 315 | 337 | - |
| 41 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 352 | 374 | - |
| 39 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 386 | 407 | - |
| 37 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 422 | 444 | - |
| 42 | g5860.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 457 | 479 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5860/g5860.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5860.t1.fa.iupred3.txt does not exist
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005337 | nucleoside transmembrane transporter activity | MF |
| GO:1901642 | nucleoside transmembrane transport | BP |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K15014 (solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
