General information for g5904.t30
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Growth hormone-inducible transmembrane protein.
Parent gene
- The parent gene g5904 is located on chr_2: 12703249..12704835 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5904 | g5904.t30 | TTS | g5904.t30 | 12703137 | 12703137 |
| chr_2 | g5904 | g5904.t30 | isoform | g5904.t30 | 12703249 | 12703822 |
| chr_2 | g5904 | g5904.t30 | exon | g5904.t30.exon1 | 12703249 | 12703583 |
| chr_2 | g5904 | g5904.t30 | cds | g5904.t30.CDS1 | 12703263 | 12703583 |
| chr_2 | g5904 | g5904.t30 | exon | g5904.t30.exon2 | 12703698 | 12703822 |
| chr_2 | g5904 | g5904.t30 | cds | g5904.t30.CDS2 | 12703698 | 12703796 |
| chr_2 | g5904 | g5904.t30 | TSS | g5904.t30 | 12704596 | 12704596 |
Sequences
>g5904.t30 Gene=g5904 Length=460
TATCAATAATCGGTACTTTTGCTGTAATGATTGGTTCAGGTATGGTGGCACAATCGATTC
CCTATTCACCTGGCTTCGGAGCAAAACAATTAGCTTGGATGGCGCATTCAGCAATCCTCG
GAGGATTCCTTAATATGGCCGGACCATTATCTATCGGTCTTGGTGTAGTGTTTGCTTCAT
CTATTGGCTCAATGTTCCTTTCCCCAGCAACAGCTCTCGGTGCATCACTCTACTCAATGA
GTTTGTACGGTGGTCTATTGTTATTCTCTGGATTTTTACTCTACGATACACAAAAGATTA
TTAGACGTGCAGAAACACATCCACCATTCGGATTTGCACCATATGATCCAATCAACAATA
GCATTTCAATTTACTTGGACACATTAAACATTTTCATTCGTATTGTCACACTTTTGGCTG
GTGGTGGTGGCAATCGACGCAAGTAAAAAGCCAAAATGTG
>g5904.t30 Gene=g5904 Length=139
MIGSGMVAQSIPYSPGFGAKQLAWMAHSAILGGFLNMAGPLSIGLGVVFASSIGSMFLSP
ATALGASLYSMSLYGGLLLFSGFLLYDTQKIIRRAETHPPFGFAPYDPINNSISIYLDTL
NIFIRIVTLLAGGGGNRRK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g5904.t30 | PANTHER | PTHR23291:SF32 | GROWTH HORMONE-INDUCIBLE TRANSMEMBRANE PROTEIN | 34 | 134 | 1.6E-32 |
| 3 | g5904.t30 | PANTHER | PTHR23291 | BAX INHIBITOR-RELATED | 34 | 134 | 1.6E-32 |
| 1 | g5904.t30 | Pfam | PF01027 | Inhibitor of apoptosis-promoting Bax1 | 34 | 130 | 5.1E-20 |
| 7 | g5904.t30 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 28 | - |
| 10 | g5904.t30 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 54 | - |
| 8 | g5904.t30 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 55 | 65 | - |
| 9 | g5904.t30 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 66 | 86 | - |
| 6 | g5904.t30 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 87 | 139 | - |
| 4 | g5904.t30 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 31 | 53 | - |
| 5 | g5904.t30 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 63 | 85 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5904/g5904.t30; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5904.t30.fa.iupred3.txt does not exist
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
