| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5936 | g5936.t1 | TSS | g5936.t1 | 12907679 | 12907679 |
| chr_2 | g5936 | g5936.t1 | isoform | g5936.t1 | 12907797 | 12908639 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon1 | 12907797 | 12907850 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS1 | 12907797 | 12907850 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon2 | 12907924 | 12908069 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS2 | 12907924 | 12908069 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon3 | 12908135 | 12908194 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS3 | 12908135 | 12908194 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon4 | 12908253 | 12908324 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS4 | 12908253 | 12908324 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon5 | 12908389 | 12908436 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS5 | 12908389 | 12908436 |
| chr_2 | g5936 | g5936.t1 | exon | g5936.t1.exon6 | 12908492 | 12908639 |
| chr_2 | g5936 | g5936.t1 | cds | g5936.t1.CDS6 | 12908492 | 12908639 |
| chr_2 | g5936 | g5936.t1 | TTS | g5936.t1 | 12909252 | 12909252 |
>g5936.t1 Gene=g5936 Length=528
ATGTCATATTCAGCTAGACCACCGCCCAAAATTGAGGGCATGATTTCTTTAAAAGTTGAC
AATTTGACTTATCGAACTACTCCCGAAGACTTGAGACGAGTTTTTGAGCGATGCGGTGAT
GTTGGTGACATTTATATTCCAAGAGATAGACATACTCGTGAGTCGAGAGGATTTGCTTTT
GTTCGATTTTATGACAAACGTGATGCTGAGGAAGCTCTTCAAGAAATGGATGGAAGAATG
CTTGATGGACGTGAATTGAGAGTGCAAATGGCCAGATATGGGAGACCTACATCTCCACAA
AGACGTTCTAACAGACACGATCGTCGCCGAAGATCCCGTTCGAGAGACCGTAGAGGAGGT
GGAGGTGGAAGACGCTCAAGATCACGTTCAAGAGACCGAAGAGGACGCCGTCGTTCATAC
TCACGTTCCAAATCTCGTTCAAGATCAGCAAATAGTCGCAGCAACAGCAAATCTTCACGC
GATCGTTCACGCTCTCCAGTTCGTAAGAATCGCAGCTCAAGCAATTAA
>g5936.t1 Gene=g5936 Length=175
MSYSARPPPKIEGMISLKVDNLTYRTTPEDLRRVFERCGDVGDIYIPRDRHTRESRGFAF
VRFYDKRDAEEALQEMDGRMLDGRELRVQMARYGRPTSPQRRSNRHDRRRRSRSRDRRGG
GGGRRSRSRSRDRRGRRRSYSRSKSRSRSANSRSNSKSSRDRSRSPVRKNRSSSN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g5936.t1 | CDD | cd12311 | RRM_SRSF2_SRSF8 | 17 | 89 | 5.52768E-41 |
| 5 | g5936.t1 | Gene3D | G3DSA:3.30.70.330 | - | 4 | 130 | 2.7E-28 |
| 9 | g5936.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 87 | 175 | - |
| 10 | g5936.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 102 | 118 | - |
| 8 | g5936.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 127 | 144 | - |
| 2 | g5936.t1 | PANTHER | PTHR23147 | SERINE/ARGININE RICH SPLICING FACTOR | 6 | 171 | 2.6E-42 |
| 3 | g5936.t1 | PANTHER | PTHR23147:SF145 | SERINE/ARGININE-RICH SPLICING FACTOR 2 | 6 | 171 | 2.6E-42 |
| 1 | g5936.t1 | Pfam | PF00076 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 18 | 87 | 1.9E-22 |
| 11 | g5936.t1 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 15 | 93 | 19.621 |
| 7 | g5936.t1 | SMART | SM00360 | rrm1_1 | 16 | 89 | 1.1E-26 |
| 4 | g5936.t1 | SUPERFAMILY | SSF54928 | RNA-binding domain, RBD | 7 | 123 | 7.93E-34 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5936/g5936.t1; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5936.t1.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003723 | RNA binding | MF |
| GO:0000381 | regulation of alternative mRNA splicing, via spliceosome | BP |
| GO:0003676 | nucleic acid binding | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.