| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5955 | g5955.t4 | TSS | g5955.t4 | 13008557 | 13008557 |
| chr_2 | g5955 | g5955.t4 | isoform | g5955.t4 | 13008875 | 13014626 |
| chr_2 | g5955 | g5955.t4 | exon | g5955.t4.exon1 | 13008875 | 13008908 |
| chr_2 | g5955 | g5955.t4 | cds | g5955.t4.CDS1 | 13008875 | 13008908 |
| chr_2 | g5955 | g5955.t4 | exon | g5955.t4.exon2 | 13014051 | 13014295 |
| chr_2 | g5955 | g5955.t4 | cds | g5955.t4.CDS2 | 13014051 | 13014295 |
| chr_2 | g5955 | g5955.t4 | exon | g5955.t4.exon3 | 13014465 | 13014626 |
| chr_2 | g5955 | g5955.t4 | cds | g5955.t4.CDS3 | 13014465 | 13014626 |
| chr_2 | g5955 | g5955.t4 | TTS | g5955.t4 | 13015402 | 13015402 |
>g5955.t4 Gene=g5955 Length=441
ATGAGCAACGATTGGGGATATACAACCAAAAATGGACCAGAGAAGTGGGCTGAAAAATTT
CCACTTGCGGCAGGAACAAGGCAATCACCGGTAAACATCATAACGTCAAAAACTCAACAG
AGCACTGATTTAGTAGTCAATCCATTGAGATGGACATATGTTGCTGACAATGTTAAATGC
TTGATTAATCCTGGATATTGCTGGAGAGTTGATGTCAAGGGTGAAGGATCAGAATTGACA
GGTGGACCACTTAATAATGATAAATATGTTATTGAACAGCTCATTGGGGATGCTCAAATG
GTCGAGGAAGTGAACATACTGTTGATGGGACTTCATTTTCTGCTGAACTGCATATTGTTC
ATTGGAATTCAAGCAAATACAATTCGTTCCAAGAAGCAGCAGGACATCCTGACGGTCTTG
CAGTTTTGGGAGTATTTTTGA
>g5955.t4 Gene=g5955 Length=146
MSNDWGYTTKNGPEKWAEKFPLAAGTRQSPVNIITSKTQQSTDLVVNPLRWTYVADNVKC
LINPGYCWRVDVKGEGSELTGGPLNNDKYVIEQLIGDAQMVEEVNILLMGLHFLLNCILF
IGIQANTIRSKKQQDILTVLQFWEYF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g5955.t4 | Gene3D | G3DSA:3.10.200.10 | Carbonic Anhydrase II | 1 | 96 | 8.4E-18 |
| 1 | g5955.t4 | Pfam | PF00194 | Eukaryotic-type carbonic anhydrase | 4 | 94 | 2.7E-16 |
| 8 | g5955.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 103 | - |
| 9 | g5955.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 104 | 123 | - |
| 7 | g5955.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 124 | 146 | - |
| 6 | g5955.t4 | ProSiteProfiles | PS51144 | Alpha-carbonic anhydrases profile. | 3 | 146 | 13.991 |
| 4 | g5955.t4 | SMART | SM01057 | Carb_anhydrase_2a | 5 | 142 | 1.9E-4 |
| 3 | g5955.t4 | SUPERFAMILY | SSF51069 | Carbonic anhydrase | 3 | 94 | 2.88E-15 |
| 2 | g5955.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 106 | 128 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5955/g5955.t4; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5955.t4.fa.iupred3.txt does not exist
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed