| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g5978 | g5978.t5 | TSS | g5978.t5 | 13154443 | 13154443 |
| chr_2 | g5978 | g5978.t5 | isoform | g5978.t5 | 13155350 | 13156060 |
| chr_2 | g5978 | g5978.t5 | exon | g5978.t5.exon1 | 13155350 | 13155681 |
| chr_2 | g5978 | g5978.t5 | cds | g5978.t5.CDS1 | 13155350 | 13155681 |
| chr_2 | g5978 | g5978.t5 | exon | g5978.t5.exon2 | 13155743 | 13155992 |
| chr_2 | g5978 | g5978.t5 | cds | g5978.t5.CDS2 | 13155743 | 13155992 |
| chr_2 | g5978 | g5978.t5 | exon | g5978.t5.exon3 | 13156055 | 13156060 |
| chr_2 | g5978 | g5978.t5 | cds | g5978.t5.CDS3 | 13156055 | 13156060 |
| chr_2 | g5978 | g5978.t5 | TTS | g5978.t5 | NA | NA |
>g5978.t5 Gene=g5978 Length=588
ATGGTTGCTTCATCGATTGCATCAGTGTCGTCATCAAATTTATTAAGAAGAAATGTTAGA
ATTTTACTAATTGGTGATCCGGGAGTTGGAAAAACCTCATTGATTCTTTCACTTGTTAGT
GAAGAATTTCCTGAAGAAGTGCCATCAAAAGCAGAAGAAATCACAATTCCAGCTGATGTA
ACACCAGAACATGTGCCCACAAATATCGTTGATTATTCGGCATTGGAACAGAGTGAAGAA
AATTTAATTGAAGAACTTCAGAAAGCTCATGTTGTATGTGTTGTTTATTCAGTGGACGAT
GAAAATTCGCTTGATCGAATCAGTTCATACTGGCTACCATTCATCCGCGAACACAATCAA
GGTGAAAATCGCAAACCCGTGGTACTTGTTGGAAATAAAATTGATTTAGTGGACTATTCA
ACGATTGATCATGTTCTCACTATCATGGAAGATTTCAATGAGATTGAAAGTTGTGTTGAA
TGCTCAGCAAAGACACTTCATAATATTTCCGAAATGTTTTATTATGCACAAAAAGCTGTT
TTGCATCCTACAGCACCGCTTTATATCATGGAAGAGCAAGATTTGACA
>g5978.t5 Gene=g5978 Length=196
MVASSIASVSSSNLLRRNVRILLIGDPGVGKTSLILSLVSEEFPEEVPSKAEEITIPADV
TPEHVPTNIVDYSALEQSEENLIEELQKAHVVCVVYSVDDENSLDRISSYWLPFIREHNQ
GENRKPVVLVGNKIDLVDYSTIDHVLTIMEDFNEIESCVECSAKTLHNISEMFYYAQKAV
LHPTAPLYIMEEQDLT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g5978.t5 | CDD | cd01893 | Miro1 | 17 | 183 | 0.0000000 |
| 8 | g5978.t5 | Gene3D | G3DSA:3.40.50.300 | - | 16 | 186 | 0.0000000 |
| 2 | g5978.t5 | PANTHER | PTHR24072:SF124 | MITOCHONDRIAL RHO GTPASE 1 | 16 | 195 | 0.0000000 |
| 3 | g5978.t5 | PANTHER | PTHR24072 | RHO FAMILY GTPASE | 16 | 195 | 0.0000000 |
| 4 | g5978.t5 | PRINTS | PR00449 | Transforming protein P21 ras signature | 19 | 40 | 0.0000000 |
| 6 | g5978.t5 | PRINTS | PR00449 | Transforming protein P21 ras signature | 123 | 136 | 0.0000000 |
| 5 | g5978.t5 | PRINTS | PR00449 | Transforming protein P21 ras signature | 158 | 180 | 0.0000000 |
| 1 | g5978.t5 | Pfam | PF00071 | Ras family | 20 | 180 | 0.0000000 |
| 14 | g5978.t5 | ProSiteProfiles | PS51423 | Miro domain profile. | 12 | 196 | 15.4030000 |
| 10 | g5978.t5 | SMART | SM00173 | ras_sub_4 | 16 | 183 | 0.0000023 |
| 11 | g5978.t5 | SMART | SM00175 | rab_sub_5 | 19 | 183 | 0.0000001 |
| 12 | g5978.t5 | SMART | SM00174 | rho_sub_3 | 21 | 183 | 0.0000000 |
| 7 | g5978.t5 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 16 | 190 | 0.0000000 |
| 13 | g5978.t5 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 18 | 176 | 0.0000000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
Data is missing for g5978/g5978.t5; file /home/yuki.yoshida/nias/analysis/reanalysis/18_revice/midgebase/iupred3/g5978.t5.fa.iupred3.txt does not exist
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0047497 | mitochondrion transport along microtubule | BP |
| GO:0031307 | integral component of mitochondrial outer membrane | CC |
| GO:0005525 | GTP binding | MF |
| GO:0003924 | GTPase activity | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed