General information for g6042.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as ATP-binding cassette sub-family G member 1.
Parent gene
- The parent gene g6042 is located on chr_2: 13789808..13791372 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6042 | g6042.t1 | TTS | g6042.t1 | 13788866 | 13788866 |
| chr_2 | g6042 | g6042.t1 | isoform | g6042.t1 | 13789808 | 13791372 |
| chr_2 | g6042 | g6042.t1 | exon | g6042.t1.exon1 | 13789808 | 13790308 |
| chr_2 | g6042 | g6042.t1 | cds | g6042.t1.CDS1 | 13789808 | 13790308 |
| chr_2 | g6042 | g6042.t1 | exon | g6042.t1.exon2 | 13790436 | 13790536 |
| chr_2 | g6042 | g6042.t1 | cds | g6042.t1.CDS2 | 13790436 | 13790536 |
| chr_2 | g6042 | g6042.t1 | exon | g6042.t1.exon3 | 13791351 | 13791372 |
| chr_2 | g6042 | g6042.t1 | cds | g6042.t1.CDS3 | 13791351 | 13791372 |
| chr_2 | g6042 | g6042.t1 | TSS | g6042.t1 | NA | NA |
Sequences
>g6042.t1 Gene=g6042 Length=624
ATGACTATTACTATTTTATCATTCCCATTGGAAATGCCTGTGCTGTTAAAAGAAAATTTC
AATCGATGGTATTCATTGCGCAGTTACTATCTAGCTATTACAATTTCTGATATTCCATTC
CAAGCAATTTTCTGTTTCATCTATGTATCGATCGTCTACTACTTTACATCACAACCTATG
GAATGGTTCCGTTATGGACTCTTTTTGACAGCTTGCTTGCTCATTTCATTCGTAGCACAA
AGTGTTGGTCTTGTAGTTGGTGCGGCCATGAATGTTCAAAATGGAGTTTTCCTTGCACCT
GTCATGTCAGTTCCATTCCTGCTTTTCTCTGGATTCTTCGTCTCATTTGATGCCATTCCA
ATTTACTTGCGTTGGATTACATATCTATCATATATTCGTTATGGTTTTGAAGCAACTGCT
TTGGCAACTTATGGTTATGGTCGTGAAAAGCTCAAATGCTCTCAAGTTTATTGTCATTTC
AAATCACCACATACAACACTTGATGAACTTGATATGCTCAAATCTGATGTTGTGTTGGAT
GTTGTTGCATTGATTTTAATTTTCTTCAATTTGAGAATTGCCGCATATTTGTTCCTCCGA
TGGAAATTGAAGACACAACGATAA
>g6042.t1 Gene=g6042 Length=207
MTITILSFPLEMPVLLKENFNRWYSLRSYYLAITISDIPFQAIFCFIYVSIVYYFTSQPM
EWFRYGLFLTACLLISFVAQSVGLVVGAAMNVQNGVFLAPVMSVPFLLFSGFFVSFDAIP
IYLRWITYLSYIRYGFEATALATYGYGREKLKCSQVYCHFKSPHTTLDELDMLKSDVVLD
VVALILIFFNLRIAAYLFLRWKLKTQR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6042.t1 | PANTHER | PTHR48041 | ABC TRANSPORTER G FAMILY MEMBER 28 | 1 | 203 | 2.3E-117 |
| 3 | g6042.t1 | PANTHER | PTHR48041:SF6 | PROTEIN WHITE-LIKE PROTEIN | 1 | 203 | 2.3E-117 |
| 1 | g6042.t1 | Pfam | PF01061 | ABC-2 type transporter | 4 | 138 | 2.4E-27 |
| 13 | g6042.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 28 | - |
| 14 | g6042.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 55 | - |
| 8 | g6042.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 56 | 66 | - |
| 16 | g6042.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 67 | 90 | - |
| 12 | g6042.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 91 | 95 | - |
| 15 | g6042.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 96 | 116 | - |
| 10 | g6042.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 117 | 127 | - |
| 17 | g6042.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 128 | 147 | - |
| 11 | g6042.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 148 | 176 | - |
| 18 | g6042.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 177 | 199 | - |
| 9 | g6042.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 200 | 207 | - |
| 6 | g6042.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 51 | - |
| 5 | g6042.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 66 | 88 | - |
| 4 | g6042.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 95 | 114 | - |
| 7 | g6042.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 177 | 199 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
