General information for g607.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative C16orf52-like protein.
Parent gene
- The parent gene g607 is located on chr_3: 4491386..4493528 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g607 | g607.t1 | TTS | g607.t1 | 4490128 | 4490128 |
| chr_3 | g607 | g607.t1 | isoform | g607.t1 | 4490823 | 4491386 |
| chr_3 | g607 | g607.t1 | exon | g607.t1.exon1 | 4490823 | 4491269 |
| chr_3 | g607 | g607.t1 | cds | g607.t1.CDS1 | 4490823 | 4491269 |
| chr_3 | g607 | g607.t1 | exon | g607.t1.exon2 | 4491330 | 4491386 |
| chr_3 | g607 | g607.t1 | cds | g607.t1.CDS2 | 4491330 | 4491386 |
| chr_3 | g607 | g607.t1 | TSS | g607.t1 | 4491471 | 4491471 |
Sequences
>g607.t1 Gene=g607 Length=504
ATGGACAAATTTTCATTAATATCTGCTGGATTATTTTCAACTGCTGGCATTTGTGCTATA
ATTGCAATTTCAAGCAGTGAATGGATTGTTGAAGTTGGAAATAACTCTAAATATGGATTA
ATGTGGTCATGCTTGACATTAGTGAATAGAACCCATCAAATTTGTTACACACCTGTTCTT
TCTGTGGAATGGCTCATTACATTAATTTTAATTTTTCTCGGAATTATTTGCATTACGACA
GTTGTCATATTATTATTTGCAAGTCGATGGGACAGAAATGTGATTTTCTATGCTCGTTGG
ATTGGATTTACAGCAATGGTTGTTTTTTGTCTGGCAGCCGTTATTTTCCCTCTAGGATTT
TACATTGAAGAAATTAACGGAGCTCAATTTCAACTACCAAACAGTCATCAAGTTGGTATT
AGTTACATTTTCTTTATATTAGCACTTTGGATTACGGTCATATCAGAGCTTTTTGCTGGA
AAAATTTGTTTACCGCATTTTTAA
>g607.t1 Gene=g607 Length=167
MDKFSLISAGLFSTAGICAIIAISSSEWIVEVGNNSKYGLMWSCLTLVNRTHQICYTPVL
SVEWLITLILIFLGIICITTVVILLFASRWDRNVIFYARWIGFTAMVVFCLAAVIFPLGF
YIEEINGAQFQLPNSHQVGISYIFFILALWITVISELFAGKICLPHF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g607.t1 | PANTHER | PTHR31186 | MODULATOR OF SMOOTHENED PROTEIN | 1 | 166 | 7.4E-58 |
| 1 | g607.t1 | Pfam | PF18800 | Attenuator of Hedgehog | 27 | 165 | 5.1E-59 |
| 11 | g607.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 26 | - |
| 12 | g607.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 5 | - |
| 13 | g607.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 6 | 21 | - |
| 17 | g607.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 22 | 26 | - |
| 9 | g607.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 27 | 63 | - |
| 16 | g607.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 64 | 88 | - |
| 7 | g607.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 89 | 99 | - |
| 14 | g607.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 122 | - |
| 10 | g607.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 123 | 141 | - |
| 15 | g607.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 142 | 164 | - |
| 8 | g607.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 165 | 167 | - |
| 4 | g607.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 5 | g607.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 65 | 87 | - |
| 3 | g607.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 100 | 122 | - |
| 6 | g607.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 137 | 159 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K23663 (modulator of smoothened protein)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
