| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g607 | g607.t4 | TTS | g607.t4 | 4490128 | 4490128 |
| chr_3 | g607 | g607.t4 | isoform | g607.t4 | 4490823 | 4491386 |
| chr_3 | g607 | g607.t4 | exon | g607.t4.exon1 | 4490823 | 4491269 |
| chr_3 | g607 | g607.t4 | cds | g607.t4.CDS1 | 4490823 | 4491206 |
| chr_3 | g607 | g607.t4 | exon | g607.t4.exon2 | 4491335 | 4491386 |
| chr_3 | g607 | g607.t4 | TSS | g607.t4 | 4491471 | 4491471 |
>g607.t4 Gene=g607 Length=499
ATGGACAAATTTTCATTAATATCTGCTGGATTATTTTCAACTGCTGGCATTTATAATTGC
AATTTCAAGCAGTGAATGGATTGTTGAAGTTGGAAATAACTCTAAATATGGATTAATGTG
GTCATGCTTGACATTAGTGAATAGAACCCATCAAATTTGTTACACACCTGTTCTTTCTGT
GGAATGGCTCATTACATTAATTTTAATTTTTCTCGGAATTATTTGCATTACGACAGTTGT
CATATTATTATTTGCAAGTCGATGGGACAGAAATGTGATTTTCTATGCTCGTTGGATTGG
ATTTACAGCAATGGTTGTTTTTTGTCTGGCAGCCGTTATTTTCCCTCTAGGATTTTACAT
TGAAGAAATTAACGGAGCTCAATTTCAACTACCAAACAGTCATCAAGTTGGTATTAGTTA
CATTTTCTTTATATTAGCACTTTGGATTACGGTCATATCAGAGCTTTTTGCTGGAAAAAT
TTGTTTACCGCATTTTTAA
>g607.t4 Gene=g607 Length=127
MWSCLTLVNRTHQICYTPVLSVEWLITLILIFLGIICITTVVILLFASRWDRNVIFYARW
IGFTAMVVFCLAAVIFPLGFYIEEINGAQFQLPNSHQVGISYIFFILALWITVISELFAG
KICLPHF
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g607.t4 | PANTHER | PTHR31186 | MODULATOR OF SMOOTHENED PROTEIN | 1 | 126 | 1.4E-47 |
| 1 | g607.t4 | Pfam | PF18800 | Attenuator of Hedgehog | 1 | 125 | 2.5E-55 |
| 9 | g607.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 23 | - |
| 12 | g607.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 24 | 48 | - |
| 7 | g607.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 49 | 59 | - |
| 11 | g607.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 82 | - |
| 8 | g607.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 83 | 101 | - |
| 10 | g607.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 102 | 124 | - |
| 6 | g607.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 125 | 127 | - |
| 4 | g607.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 25 | 47 | - |
| 5 | g607.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 82 | - |
| 3 | g607.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 97 | 119 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed