General information for g6091.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ethanolaminephosphotransferase 1.
Parent gene
- The parent gene g6091 is located on chr_2: 14077472..14079195 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6091 | g6091.t1 | TTS | g6091.t1 | 14076607 | 14076607 |
| chr_2 | g6091 | g6091.t1 | isoform | g6091.t1 | 14076799 | 14079195 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon1 | 14076799 | 14076855 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS1 | 14076799 | 14076855 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon2 | 14076925 | 14077173 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS2 | 14076925 | 14077173 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon3 | 14077230 | 14077410 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS3 | 14077230 | 14077410 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon4 | 14077474 | 14077697 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS4 | 14077474 | 14077697 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon5 | 14077785 | 14077921 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS5 | 14077785 | 14077921 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon6 | 14077978 | 14078215 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS6 | 14077978 | 14078215 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon7 | 14078270 | 14078338 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS7 | 14078270 | 14078338 |
| chr_2 | g6091 | g6091.t1 | exon | g6091.t1.exon8 | 14079139 | 14079195 |
| chr_2 | g6091 | g6091.t1 | cds | g6091.t1.CDS8 | 14079139 | 14079195 |
| chr_2 | g6091 | g6091.t1 | TSS | g6091.t1 | 14079278 | 14079278 |
Sequences
>g6091.t1 Gene=g6091 Length=1212
ATGTGGAAAATAAAGTACTTGAATAAAGATCATTTAGAAGGTTTTGATAGATATAAGTAC
AACTGTGTCGATACTAGTTGGCTCAGCAAACATGTGATGCACAAATTTTGGGATTTTATT
GTTAAGTTTGTTCCAGTTAATATTGCACCTAATCTCATCACATTTTCCGGATTTATGCTC
ACCGTATTTAACTACATTCTCATAGCGTTTTATGACTACTATTTTCGAGTAGCTAACGAT
CCATTTGGCGAACAAATTCCGCGTTGGGTTTTTATAGTCGCGGGTATTAATGTTTTTGTT
GCTTATACACTAGATGGAATCGACGGAAAACATGCAAGGAGAACAGGAACTTCATCACCT
TTAGGAGAGCTTTTTGACCATGGACTTGATTCATATTCAAGTATCTTTATCATGATTTAT
CTCTTCAGTCTTTTTGGCTCACATGATTTGCCACAAATGCGAATGCATTTTATTACTTAC
TGTGTTTACTTAAATTTTTATCTCACACATTTTGAAAAATATAACACTGGAGTGTTATTT
TTGCCTTATGCCTATGATTATGTCATGTGGAGTTGCAGTATTACGCTGCTTGTGGCTGGA
TTTTTTGGTCCACAATTATTTACAACTCCTATTTTTGGCATCAAACCAACAGTTTATGTT
GAATTCATAATGTACATAGCGGGAATTGTTACTAGCCATCCTGTAATTGCATGGAATATT
TACAAGTCATATCGTGATAAAACAGGAAAAATGAGACCGCTCGTGGAAGCCTTTAGACCA
CTTTATCCAGTTGCAGGACTTTTTGTAATATCAACACTGTGGGTTGTATTTTCACCAAAT
GAAATCATGAAAGTTGATCCACGAATGTTCATTATGGTGACAGGCACAATATTCTCCAAT
ATAAGTTGCAGACTGATTGTTGCCCAAATGAGTGACACGCGAACGGACGGTTGGAATTTG
CAATTGTGGGGATATTTATTCGCAACTTTCATTTGCATTTTCCCTTACGAATGTATCGAA
ATGCCTCGACTTCCACAGCATTGTGAATATGGAATTTTGTTGACGTTAGTCGTCGTATTT
AGTGTACAACATTTTCATTATGGCTATGGTGTAGTTACAGAAATGTGTCAGCATTTTGGT
ATAAAATGCTTCACGATTAAACCAAAAGTGCCAACAAAAAATGGAAATGGCGAAGCCGTG
CATAGTGTATGA
>g6091.t1 Gene=g6091 Length=403
MWKIKYLNKDHLEGFDRYKYNCVDTSWLSKHVMHKFWDFIVKFVPVNIAPNLITFSGFML
TVFNYILIAFYDYYFRVANDPFGEQIPRWVFIVAGINVFVAYTLDGIDGKHARRTGTSSP
LGELFDHGLDSYSSIFIMIYLFSLFGSHDLPQMRMHFITYCVYLNFYLTHFEKYNTGVLF
LPYAYDYVMWSCSITLLVAGFFGPQLFTTPIFGIKPTVYVEFIMYIAGIVTSHPVIAWNI
YKSYRDKTGKMRPLVEAFRPLYPVAGLFVISTLWVVFSPNEIMKVDPRMFIMVTGTIFSN
ISCRLIVAQMSDTRTDGWNLQLWGYLFATFICIFPYECIEMPRLPQHCEYGILLTLVVVF
SVQHFHYGYGVVTEMCQHFGIKCFTIKPKVPTKNGNGEAVHSV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g6091.t1 | Gene3D | G3DSA:1.20.120.1760 | - | 21 | 214 | 1.6E-17 |
| 2 | g6091.t1 | PANTHER | PTHR10414:SF36 | GH11618P | 1 | 389 | 2.9E-165 |
| 3 | g6091.t1 | PANTHER | PTHR10414 | ETHANOLAMINEPHOSPHOTRANSFERASE | 1 | 389 | 2.9E-165 |
| 35 | g6091.t1 | PIRSF | PIRSF015665 | CHOPT | 3 | 396 | 1.8E-116 |
| 1 | g6091.t1 | Pfam | PF01066 | CDP-alcohol phosphatidyltransferase | 49 | 130 | 6.0E-17 |
| 24 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 51 | - |
| 26 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 52 | 74 | - |
| 18 | g6091.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 75 | 85 | - |
| 25 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 104 | - |
| 21 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 105 | 123 | - |
| 27 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 124 | 145 | - |
| 14 | g6091.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 146 | 156 | - |
| 32 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 175 | - |
| 20 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 176 | 186 | - |
| 30 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 187 | 207 | - |
| 16 | g6091.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 208 | 218 | - |
| 29 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 219 | 241 | - |
| 23 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 242 | 260 | - |
| 34 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 261 | 277 | - |
| 17 | g6091.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 278 | 288 | - |
| 28 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 289 | 310 | - |
| 22 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 311 | 321 | - |
| 33 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 322 | 339 | - |
| 15 | g6091.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 340 | 350 | - |
| 31 | g6091.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 351 | 369 | - |
| 19 | g6091.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 370 | 403 | - |
| 12 | g6091.t1 | ProSitePatterns | PS00379 | CDP-alcohol phosphatidyltransferases signature. | 108 | 130 | - |
| 11 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 70 | - |
| 6 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 104 | - |
| 5 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 181 | 203 | - |
| 9 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 218 | 240 | - |
| 8 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 261 | 278 | - |
| 7 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 288 | 307 | - |
| 4 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 320 | 339 | - |
| 10 | g6091.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 350 | 372 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0008654 | phospholipid biosynthetic process | BP |
| GO:0016780 | phosphotransferase activity, for other substituted phosphate groups | MF |
KEGG
Orthology
- This transcript has been annotated with K00993 (ethanolaminephosphotransferase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
