| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6091 | g6091.t4 | TTS | g6091.t4 | 14076607 | 14076607 |
| chr_2 | g6091 | g6091.t4 | isoform | g6091.t4 | 14077472 | 14078338 |
| chr_2 | g6091 | g6091.t4 | exon | g6091.t4.exon1 | 14077472 | 14077697 |
| chr_2 | g6091 | g6091.t4 | cds | g6091.t4.CDS1 | 14077473 | 14077697 |
| chr_2 | g6091 | g6091.t4 | exon | g6091.t4.exon2 | 14077785 | 14077921 |
| chr_2 | g6091 | g6091.t4 | cds | g6091.t4.CDS2 | 14077785 | 14077921 |
| chr_2 | g6091 | g6091.t4 | exon | g6091.t4.exon3 | 14077978 | 14078215 |
| chr_2 | g6091 | g6091.t4 | cds | g6091.t4.CDS3 | 14077978 | 14078215 |
| chr_2 | g6091 | g6091.t4 | exon | g6091.t4.exon4 | 14078270 | 14078338 |
| chr_2 | g6091 | g6091.t4 | cds | g6091.t4.CDS4 | 14078270 | 14078299 |
| chr_2 | g6091 | g6091.t4 | TSS | g6091.t4 | 14079278 | 14079278 |
>g6091.t4 Gene=g6091 Length=670
TACAACTGTGTCGATACTAGTTGGCTCAGCAAACATGTGATGCACAAATTTTGGGATTTT
ATTGTTAAGTTTGTTCCAGTTAATATTGCACCTAATCTCATCACATTTTCCGGATTTATG
CTCACCGTATTTAACTACATTCTCATAGCGTTTTATGACTACTATTTTCGAGTAGCTAAC
GATCCATTTGGCGAACAAATTCCGCGTTGGGTTTTTATAGTCGCGGGTATTAATGTTTTT
GTTGCTTATACACTAGATGGAATCGACGGAAAACATGCAAGGAGAACAGGAACTTCATCA
CCTTTAGGAGAGCTTTTTGACCATGGACTTGATTCATATTCAAGTATCTTTATCATGATT
TATCTCTTCAGTCTTTTTGGCTCACATGATTTGCCACAAATGCGAATGCATTTTATTACT
TACTGTGTTTACTTAAATTTTTATCTCACACATTTTGAAAAATATAACACTGGAGTGTTA
TTTTTGCCTTATGCCTATGATTATGTCATGTGGAGTTGCAGTATTACGCTGCTTGTGGCT
GGATTTTTTGGTCCACAATTATTTACAACTCCTATTTTTGGCATCAAACCAACAGTTTAT
GTTGAATTCATAATGTACATAGCGGGAATTGTTACTAGCCATCCTGTAATTGCATGGAAT
ATTTACAAGT
>g6091.t4 Gene=g6091 Length=210
MHKFWDFIVKFVPVNIAPNLITFSGFMLTVFNYILIAFYDYYFRVANDPFGEQIPRWVFI
VAGINVFVAYTLDGIDGKHARRTGTSSPLGELFDHGLDSYSSIFIMIYLFSLFGSHDLPQ
MRMHFITYCVYLNFYLTHFEKYNTGVLFLPYAYDYVMWSCSITLLVAGFFGPQLFTTPIF
GIKPTVYVEFIMYIAGIVTSHPVIAWNIYK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g6091.t4 | Gene3D | G3DSA:1.20.120.1760 | - | 4 | 170 | 6.1E-17 |
| 2 | g6091.t4 | PANTHER | PTHR10414:SF36 | GH11618P | 1 | 210 | 4.3E-88 |
| 3 | g6091.t4 | PANTHER | PTHR10414 | ETHANOLAMINEPHOSPHOTRANSFERASE | 1 | 210 | 4.3E-88 |
| 1 | g6091.t4 | Pfam | PF01066 | CDP-alcohol phosphatidyltransferase | 17 | 98 | 1.7E-17 |
| 15 | g6091.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 19 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
| 11 | g6091.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 43 | 53 | - |
| 18 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 72 | - |
| 14 | g6091.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 73 | 91 | - |
| 20 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 113 | - |
| 13 | g6091.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 114 | 124 | - |
| 22 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 125 | 143 | - |
| 16 | g6091.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 144 | 154 | - |
| 21 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 155 | 175 | - |
| 12 | g6091.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 176 | 186 | - |
| 23 | g6091.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 187 | 209 | - |
| 17 | g6091.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 210 | 210 | - |
| 9 | g6091.t4 | ProSitePatterns | PS00379 | CDP-alcohol phosphatidyltransferases signature. | 76 | 98 | - |
| 6 | g6091.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 42 | - |
| 5 | g6091.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 72 | - |
| 4 | g6091.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 114 | - |
| 7 | g6091.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 145 | 167 | - |
| 8 | g6091.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 187 | 209 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0008654 | phospholipid biosynthetic process | BP |
| GO:0016780 | phosphotransferase activity, for other substituted phosphate groups | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.