General information for g6116.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Gamma-aminobutyric acid type B receptor subunit 1.
Parent gene
- The parent gene g6116 is located on chr_2: 14233485..14253970 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6116 | g6116.t1 | isoform | g6116.t1 | 14233485 | 14253970 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon1 | 14233485 | 14233775 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS1 | 14233485 | 14233775 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon2 | 14234115 | 14234252 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS2 | 14234115 | 14234252 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon3 | 14235782 | 14235871 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS3 | 14235782 | 14235871 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon4 | 14235945 | 14236111 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS4 | 14235945 | 14236111 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon5 | 14237642 | 14237849 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS5 | 14237642 | 14237849 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon6 | 14237973 | 14238089 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS6 | 14237973 | 14238089 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon7 | 14241807 | 14241930 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS7 | 14241807 | 14241930 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon8 | 14244342 | 14244484 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS8 | 14244342 | 14244484 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon9 | 14244544 | 14244693 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS9 | 14244544 | 14244693 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon10 | 14249887 | 14250130 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS10 | 14249887 | 14250130 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon11 | 14251322 | 14251487 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS11 | 14251322 | 14251487 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon12 | 14253368 | 14253755 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS12 | 14253368 | 14253755 |
| chr_2 | g6116 | g6116.t1 | exon | g6116.t1.exon13 | 14253863 | 14253970 |
| chr_2 | g6116 | g6116.t1 | cds | g6116.t1.CDS13 | 14253863 | 14253970 |
| chr_2 | g6116 | g6116.t1 | TSS | g6116.t1 | NA | NA |
| chr_2 | g6116 | g6116.t1 | TTS | g6116.t1 | NA | NA |
Sequences
>g6116.t1 Gene=g6116 Length=2334
ATGTATGACCTTTTATATCATAAGCCCCAAAAGTTACTGTTATTAGCGGGCTGTAGTACT
GTATGTACAACAGTGGCGGAAGCTGCAAAAATGTGGAATTTAGTAGTATTATGTTATGGT
GCTTCAAGTCCTGCCTTATCAGATCGTAGTCGATTTCCAACATTATTTCGAACACACCCA
TCTGCCACCGTTCACAATCCAACTAGAATTAAGTTAATGCAAAAATTCGGCTGGTCGAAA
ATTGCAATATTGCAGCAGGCCGAAGAAGTTTTTATATCAACTGTAGAAGATTTAGAAGAT
CGTTGTAAGAACGCGCAAATAGAGATAGTTACACGACAATCATTTTTATCAGATCCAACA
GATGCTGTTCGAAATCTTCGACGGCAAGATGCACGAATCATTGTTGGCCTTTTTTATGTG
GTCGCAGCGAGACGTGTGCTGTGTGAAATGTATAAACAGCAACTTTATGGTCGCTCATAT
GTATGGTTCTTTATTGGCTGGTATGAAGACAATTGGTATGAGCAAAATTTAAAGAGTGAA
AACATCTCCTGTACTAGGGAGGAAATGAGGCGAGCGGCTGAAGGACATTTAACGACTGAG
GCATTGATGTGGAATCAGAATAATCAGAAAACAATATCCGGAATGTCATCAGAGGATTTT
AGACAACGTCTCAATGAAGATCTCATGAAACGCGGCTATGACATCGAACATAATCGTTAT
CCAGAGGGCTATCAAGAGGCGCCTTTGGCATACGATGCTGTATGGAGCGTTGCACTCGCT
TTTAATAAAACAATGGAACGACTAAAGCTGAAAAAGAAATCGCTTAAAGATTTCACATAT
ACAGATAAGGAGATTGCGGATGAGATTTATGCAGCAATGAATTCAACACAATTCCTGGGC
GTATCGGGAGTTGTGGCTTTCAGTTCACAAGGTGATCGTATAGCGCTAACGCAAATTGAA
CAAATGAACGACGGTCAATACCATAAATTAGGATATTACGACACTCAAGCCGATAATTTA
ACGTGGTTCAATAGAGAACAATGGATTGGTGGGAAGGTTCCACAAGATCGCACAATAGTT
CGACGAGTGCTTCGAACAGTTTCATTACCATTATTTATTTGCATGAGTGCTGTATCATGT
ATAGGCATCTTTGTTGCTGCATTTCTAATTGTGTTCAATATTTGGAATCGTCATAGAAGA
GTAATTCAACAATCACATCCAGTGTGCAATACAATAATGCTCTTTGGTATAATAACATGT
TTAATTTCTGTGGTTTTACTTGGTCTCGATGGACAATTTGTCGATGCGTCAACATATCCT
CAGATTTGTCAAGCACGAGCATGGATGCTCTCGATGGGATTTACATTGGCATTTGGAGCA
ATGTTTAGCAAAGTGTGGCGCGTCCATCGATTTACAACGAAAGCAAAAACAGATCCAAAG
AAAAAAGTGGAACCATGGAAACTTTATACAATGGTGTCTGGACTTTTAGTAGTTGATATT
GTGATACTATTAACATGGCAACTACAAGATCCACTTGAGAGGCGACTCGAAACATTTCCG
CTCGAAGATCCAATATCAATAACTGACGATGTAAAAATTAGGCCAGAATTAGAACATTGT
GAAAGTGAAAATAATGCTGTATGGCTAGGTGTTATGTATGGATTCAAAGGTCTGATTCTT
GTGTTTGGACTTTTTCTTGCATACGAAACAAGATCAATAAAAGTCAAACAAATAAATGAT
TCACGATATGTCGGCATGAGCATTTATAACATTGCTGTTCTTTGTCTAATCACTGCACCT
GTGGCAATGGTTATTGCTTCGCAACAGGATGCATCGTATGCTTTTGTAGCGCTTGCCGTT
ATTTTTTGTTGTTTTCTCAGCATGTTGCTGATTTTTGTGCCAAAAGTAATTGAAGTTATG
AGACATCCTCACGATAAAGCCGAATCACGATTCAGCAATGATACGGGAATATCGAAGGAG
GATGAAGAACGTTATAAAAAATTAGTACTGGAAAATGAAGAGCTTCAGAAATTGATTGCT
CAAAAAGAGGAAAAAATAAGGATATTAAAACAGCGTCTAGCAGAGCGAGAATCGAAAGGC
GAAATACAATCAAGCTCACAGCAAGTAACAATAAATAATGGCACGATGGGCTCATCAAAT
CAATTAGGATTAAATCAAGGTAAGGAAATCAATTATGGCGGAGGACTTCAAGTCATCATA
CAAGCTGAACAGCCAACCATATCTGATTTTGATAGTGCATTTGGAAATGGCAATTTCTCA
ATTTCCGCATGCACGCGCTCATCCGATGTTGAATTTTCAGAAAGTTATTTGTAA
>g6116.t1 Gene=g6116 Length=777
MYDLLYHKPQKLLLLAGCSTVCTTVAEAAKMWNLVVLCYGASSPALSDRSRFPTLFRTHP
SATVHNPTRIKLMQKFGWSKIAILQQAEEVFISTVEDLEDRCKNAQIEIVTRQSFLSDPT
DAVRNLRRQDARIIVGLFYVVAARRVLCEMYKQQLYGRSYVWFFIGWYEDNWYEQNLKSE
NISCTREEMRRAAEGHLTTEALMWNQNNQKTISGMSSEDFRQRLNEDLMKRGYDIEHNRY
PEGYQEAPLAYDAVWSVALAFNKTMERLKLKKKSLKDFTYTDKEIADEIYAAMNSTQFLG
VSGVVAFSSQGDRIALTQIEQMNDGQYHKLGYYDTQADNLTWFNREQWIGGKVPQDRTIV
RRVLRTVSLPLFICMSAVSCIGIFVAAFLIVFNIWNRHRRVIQQSHPVCNTIMLFGIITC
LISVVLLGLDGQFVDASTYPQICQARAWMLSMGFTLAFGAMFSKVWRVHRFTTKAKTDPK
KKVEPWKLYTMVSGLLVVDIVILLTWQLQDPLERRLETFPLEDPISITDDVKIRPELEHC
ESENNAVWLGVMYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNIAVLCLITAP
VAMVIASQQDASYAFVALAVIFCCFLSMLLIFVPKVIEVMRHPHDKAESRFSNDTGISKE
DEERYKKLVLENEELQKLIAQKEEKIRILKQRLAERESKGEIQSSSQQVTINNGTMGSSN
QLGLNQGKEINYGGGLQVIIQAEQPTISDFDSAFGNGNFSISACTRSSDVEFSESYL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 50 | g6116.t1 | CDD | cd06366 | PBP1_GABAb_receptor | 1 | 350 | 1.79061E-167 |
| 49 | g6116.t1 | CDD | cd15291 | 7tmC_GABA-B-R1 | 370 | 641 | 3.91965E-165 |
| 29 | g6116.t1 | Coils | Coil | Coil | 658 | 699 | - |
| 27 | g6116.t1 | Gene3D | G3DSA:3.40.50.2300 | - | 1 | 317 | 1.9E-127 |
| 28 | g6116.t1 | Gene3D | G3DSA:3.40.50.2300 | - | 63 | 339 | 1.9E-127 |
| 3 | g6116.t1 | PANTHER | PTHR10519:SF42 | GAMMA-AMINOBUTYRIC ACID TYPE B RECEPTOR SUBUNIT 1 | 1 | 708 | 0.0 |
| 4 | g6116.t1 | PANTHER | PTHR10519 | GABA-B RECEPTOR | 1 | 708 | 0.0 |
| 16 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 18 | 46 | 2.0E-113 |
| 10 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 23 | 40 | 7.7E-59 |
| 19 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 53 | 72 | 2.0E-113 |
| 14 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 115 | 138 | 2.0E-113 |
| 17 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 145 | 168 | 2.0E-113 |
| 8 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 246 | 264 | 7.7E-59 |
| 6 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 312 | 335 | 7.7E-59 |
| 12 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 370 | 395 | 7.7E-59 |
| 18 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 371 | 394 | 2.0E-113 |
| 24 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 410 | 431 | 2.0E-113 |
| 5 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 412 | 433 | 7.7E-59 |
| 15 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 443 | 462 | 2.0E-113 |
| 21 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 462 | 479 | 2.0E-113 |
| 20 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 492 | 517 | 2.0E-113 |
| 23 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 530 | 550 | 2.0E-113 |
| 13 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 579 | 602 | 2.0E-113 |
| 9 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 583 | 605 | 7.7E-59 |
| 11 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 610 | 633 | 7.7E-59 |
| 22 | g6116.t1 | PRINTS | PR01176 | Metabotropic gamma-aminobutyric acid type B receptor signature | 613 | 635 | 2.0E-113 |
| 7 | g6116.t1 | PRINTS | PR01177 | Metabotropic gamma-aminobutyric acid type B1 receptor signature | 663 | 681 | 7.7E-59 |
| 1 | g6116.t1 | Pfam | PF01094 | Receptor family ligand binding region | 14 | 324 | 7.1E-48 |
| 2 | g6116.t1 | Pfam | PF00003 | 7 transmembrane sweet-taste receptor of 3 GCPR | 383 | 636 | 9.4E-59 |
| 38 | g6116.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 28 | - |
| 39 | g6116.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 11 | - |
| 40 | g6116.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 12 | 23 | - |
| 48 | g6116.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 24 | 28 | - |
| 36 | g6116.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 29 | 368 | - |
| 42 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 369 | 395 | - |
| 30 | g6116.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 396 | 406 | - |
| 44 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 407 | 427 | - |
| 37 | g6116.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 428 | 446 | - |
| 47 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 447 | 466 | - |
| 33 | g6116.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 467 | 485 | - |
| 43 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 486 | 506 | - |
| 34 | g6116.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 507 | 545 | - |
| 45 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 546 | 568 | - |
| 31 | g6116.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 569 | 587 | - |
| 41 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 588 | 607 | - |
| 35 | g6116.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 608 | 612 | - |
| 46 | g6116.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 613 | 633 | - |
| 32 | g6116.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 634 | 777 | - |
| 58 | g6116.t1 | ProSiteProfiles | PS50259 | G-protein coupled receptors family 3 profile. | 378 | 655 | 26.11 |
| 25 | g6116.t1 | SUPERFAMILY | SSF53822 | Periplasmic binding protein-like I | 2 | 357 | 1.68E-63 |
| 26 | g6116.t1 | SignalP_GRAM_POSITIVE | SignalP-TM | SignalP-TM | 1 | 28 | - |
| 56 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 372 | 394 | - |
| 57 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 407 | 429 | - |
| 55 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 444 | 466 | - |
| 54 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 486 | 508 | - |
| 53 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 546 | 568 | - |
| 52 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 588 | 607 | - |
| 51 | g6116.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 611 | 633 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0004965 | G protein-coupled GABA receptor activity | MF |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
- This transcript has been annotated with K04615 (gamma-aminobutyric acid type B receptor)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed