General information for g6175.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Phosphatidylinositol glycan anchor biosynthesis class U protein.
Parent gene
- The parent gene g6175 is located on chr_2: 14898248..14899646 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6175 | g6175.t1 | TTS | g6175.t1 | 14898109 | 14898109 |
| chr_2 | g6175 | g6175.t1 | isoform | g6175.t1 | 14898248 | 14899646 |
| chr_2 | g6175 | g6175.t1 | exon | g6175.t1.exon1 | 14898248 | 14899198 |
| chr_2 | g6175 | g6175.t1 | cds | g6175.t1.CDS1 | 14898248 | 14899198 |
| chr_2 | g6175 | g6175.t1 | exon | g6175.t1.exon2 | 14899257 | 14899456 |
| chr_2 | g6175 | g6175.t1 | cds | g6175.t1.CDS2 | 14899257 | 14899456 |
| chr_2 | g6175 | g6175.t1 | exon | g6175.t1.exon3 | 14899517 | 14899646 |
| chr_2 | g6175 | g6175.t1 | cds | g6175.t1.CDS3 | 14899517 | 14899646 |
| chr_2 | g6175 | g6175.t1 | TSS | g6175.t1 | 14899724 | 14899724 |
Sequences
>g6175.t1 Gene=g6175 Length=1281
ATGAACAAAAAGTTATTATATAGTCTATTGATAAGTGGTGCCATCCGCTATTTCATATCG
ATATCAAAGTATTCACGAAGCATAGAAAATCACGTTGAAATTTCCACACCTTTGAATTCT
TTCAAAAGATTGAAAGAAGGAGTGTTCTTGTATGATAATGGAATTGATCCTTATGACGGA
GACATCTTTCATGAAAGTCCATTTATATTAATAGCCGCAAATTTTTTGCTTAAGAATTTT
GGAGAATTCATTTCACTTATTCTAATTATAATTGATCTCTTAAGCGCTGTGTTTATCTAT
TATGGTAGCAAATCAATTAGTAAAAGAAACTATGAAAGACAACAACTGGAAGTTTCAACT
TATGCAAAAGGAACTGAGGAAATTCAATTTAGTAAGAGTGACATTGATAATATTCCTTTC
ATCTGTGCATTTGCGTATCTTTTTAATCCTTATTCAATTTTAAATTGTGTCGGACAAACA
ACTACAGTATGGAGCAATTTTTTGCTCTCAGTAGTGATCTATTCAATGTCGAAAAACATG
AAATTTATCTGTTTACTTGCATTAGCATTTGAAACACAAAAAAACTTTTATCCATTCGTT
CTAATCGTCCCCATAGCTTTAGCATTCAGTGAAAATGACAAATCAAAGAATTTAAAAAGA
ATAATAACAGTTGTGACATTTGCTTCAATTTTTGGCCTTTTAAATTACATTGCATTCACT
TACATGGGAAATTGGAAATTTTTAGATTCAACATTTGGATTCATTATTCATTGTCGTGAT
CTTACACCTAATATAGGACTCTTCTGGTACTTCTTTACTGAAATGTTTGATCACTTTCGA
GAACTTTTTCTCTATACATTCCAATTAAATACTACCATACTATATCTTTTTCCATTAACC
TTCACATTCAAAGAATCCCCTGAATTTCTTTTAACAATCCTACTCTCGCTCGTAACAATT
TTCTCATCGTACCCTTGCATTGGAGCAATTGCATTTTATATGTCACTTATACCTCTCTGG
AAACGTTGCTCACCATTCATGTCACACAATTTTATAGTGATTGCTACTTTTATTGTCACA
TCCATTCTCGGACCAACTGTCTATCATTTATGGATGTATGCCAACTCTGCAAATGCTAAC
TTTTACTTCGGTGTTACTCTTGTTTTCTGCACAAGTCAAATTTTCTTGTTGACTGATTTA
TGTTTTGCATATTTAAAGCGCAAGTTCTGCCTAACTAATGGAGTTACTTTTGATAAAACT
ATGAAATTATCATTAGAATAA
>g6175.t1 Gene=g6175 Length=426
MNKKLLYSLLISGAIRYFISISKYSRSIENHVEISTPLNSFKRLKEGVFLYDNGIDPYDG
DIFHESPFILIAANFLLKNFGEFISLILIIIDLLSAVFIYYGSKSISKRNYERQQLEVST
YAKGTEEIQFSKSDIDNIPFICAFAYLFNPYSILNCVGQTTTVWSNFLLSVVIYSMSKNM
KFICLLALAFETQKNFYPFVLIVPIALAFSENDKSKNLKRIITVVTFASIFGLLNYIAFT
YMGNWKFLDSTFGFIIHCRDLTPNIGLFWYFFTEMFDHFRELFLYTFQLNTTILYLFPLT
FTFKESPEFLLTILLSLVTIFSSYPCIGAIAFYMSLIPLWKRCSPFMSHNFIVIATFIVT
SILGPTVYHLWMYANSANANFYFGVTLVFCTSQIFLLTDLCFAYLKRKFCLTNGVTFDKT
MKLSLE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6175.t1 | PANTHER | PTHR13121 | GPI TRANSAMIDASE COMPONENT PIG-U | 3 | 414 | 4.6E-105 |
| 1 | g6175.t1 | Pfam | PF06728 | GPI transamidase subunit PIG-U | 11 | 389 | 7.1E-110 |
| 20 | g6175.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 27 | - |
| 21 | g6175.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 4 | - |
| 22 | g6175.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 5 | 15 | - |
| 32 | g6175.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 16 | 27 | - |
| 18 | g6175.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 28 | 82 | - |
| 23 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 103 | - |
| 14 | g6175.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 104 | 166 | - |
| 28 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 167 | 190 | - |
| 16 | g6175.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 191 | 195 | - |
| 24 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 196 | 212 | - |
| 11 | g6175.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 213 | 220 | - |
| 26 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 239 | - |
| 15 | g6175.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 240 | 250 | - |
| 29 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 251 | 270 | - |
| 13 | g6175.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 271 | 281 | - |
| 30 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 282 | 303 | - |
| 17 | g6175.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 304 | 308 | - |
| 31 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 309 | 339 | - |
| 10 | g6175.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 340 | 350 | - |
| 27 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 351 | 371 | - |
| 19 | g6175.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 372 | 382 | - |
| 25 | g6175.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 383 | 405 | - |
| 12 | g6175.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 406 | 426 | - |
| 5 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 80 | 102 | - |
| 3 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 221 | 243 | - |
| 7 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 253 | 272 | - |
| 9 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 279 | 301 | - |
| 4 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 311 | 333 | - |
| 8 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 346 | 368 | - |
| 6 | g6175.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 383 | 405 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0042765 | GPI-anchor transamidase complex | CC |
| GO:0016021 | integral component of membrane | CC |
| GO:0016255 | attachment of GPI anchor to protein | BP |
KEGG
Orthology
- This transcript has been annotated with K05293 (GPI-anchor transamidase subunit U)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
