| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6204 | g6204.t1 | TTS | g6204.t1 | 15252090 | 15252090 |
| chr_2 | g6204 | g6204.t1 | isoform | g6204.t1 | 15252527 | 15253706 |
| chr_2 | g6204 | g6204.t1 | exon | g6204.t1.exon1 | 15252527 | 15252961 |
| chr_2 | g6204 | g6204.t1 | cds | g6204.t1.CDS1 | 15252527 | 15252961 |
| chr_2 | g6204 | g6204.t1 | exon | g6204.t1.exon2 | 15253503 | 15253544 |
| chr_2 | g6204 | g6204.t1 | cds | g6204.t1.CDS2 | 15253503 | 15253544 |
| chr_2 | g6204 | g6204.t1 | exon | g6204.t1.exon3 | 15253623 | 15253706 |
| chr_2 | g6204 | g6204.t1 | cds | g6204.t1.CDS3 | 15253623 | 15253706 |
| chr_2 | g6204 | g6204.t1 | TSS | g6204.t1 | 15254068 | 15254068 |
>g6204.t1 Gene=g6204 Length=561
ATGGCGCTATTCGCTGCTGCAAGATCATTTTTTCGGAAGCACCCGCTAATAGCCAACTGC
AGTACGTATGGTCTTCTTTATGTGGGTGCTGAATTTAGTCAACAAACTGTGACGAAGAAA
TTTTTGACTTCACCTTCACAAGATATTGATAAACCAACACTAGTACGATATGCAGTAATG
GGAACATTTATTTACTCACCAATTCTATACAATTGGTACAAATGGCTTGATGGTCGATTT
CCCGGTATAGCACGCAAGACAATTCTAAAAAAGCTAGTTCTTGATCAATTTCTTCTAACG
CCTCCACTTCTCGTAATTTTCTATACTGGAATGTCATTGATGGAATTAAAATTTGATGAT
CCATTTGAAGAATGTAGAAAAAAATTTGTAACAACTTTCCAACGCTCATGCATGTTCTGG
TTGCCTGCTCAAACTGTGAATTTCATTTTAATTCCGCCAGCATTTCGAGTTATTTACATG
GGTTTTGCTAGCTTCTGTTGGGTCAATATATTGTGCTTCCTTAAGAGACAAAAGTTGGAA
GAATTTGAAGTTGCGAACTAA
>g6204.t1 Gene=g6204 Length=186
MALFAAARSFFRKHPLIANCSTYGLLYVGAEFSQQTVTKKFLTSPSQDIDKPTLVRYAVM
GTFIYSPILYNWYKWLDGRFPGIARKTILKKLVLDQFLLTPPLLVIFYTGMSLMELKFDD
PFEECRKKFVTTFQRSCMFWLPAQTVNFILIPPAFRVIYMGFASFCWVNILCFLKRQKLE
EFEVAN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6204.t1 | PANTHER | PTHR11266:SF85 | MPV17-LIKE PROTEIN | 4 | 178 | 3.6E-76 |
| 3 | g6204.t1 | PANTHER | PTHR11266 | PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17 | 4 | 178 | 3.6E-76 |
| 1 | g6204.t1 | Pfam | PF04117 | Mpv17 / PMP22 family | 116 | 172 | 7.2E-17 |
| 11 | g6204.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 53 | - |
| 14 | g6204.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 54 | 73 | - |
| 8 | g6204.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 74 | 92 | - |
| 13 | g6204.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 93 | 111 | - |
| 10 | g6204.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 112 | 156 | - |
| 12 | g6204.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 157 | 174 | - |
| 9 | g6204.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 175 | 186 | - |
| 5 | g6204.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 16 | 38 | - |
| 6 | g6204.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 72 | - |
| 4 | g6204.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 114 | - |
| 7 | g6204.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 149 | 171 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016021 | integral component of membrane | CC |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed