Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6209 g6209.t33 TSS g6209.t33 15265870 15265870
chr_2 g6209 g6209.t33 isoform g6209.t33 15266230 15266677
chr_2 g6209 g6209.t33 exon g6209.t33.exon1 15266230 15266360
chr_2 g6209 g6209.t33 exon g6209.t33.exon2 15266426 15266677
chr_2 g6209 g6209.t33 cds g6209.t33.CDS1 15266489 15266677
chr_2 g6209 g6209.t33 TTS g6209.t33 15266763 15266763

Sequences

>g6209.t33 Gene=g6209 Length=383
ATTTACATCTAACAAAGTTTGTTGTCAAATTTCCATTTACGGCACCAACACGTATTGTGA
AAAAAGCTCTAGAGGATTTCAAGATTAAAGAAAAATGGAGTCAAACACTTTGGGCAGAAC
GCGCAAAAGCACGTTCAAATTTGGATGATTTCGAGCGCTTCAAGTTGCGATTAGTTAAGC
GTTCAAAGAATCGCATGATCGAGCCAGTCTTTTCAAAGCTCAAGAAAGAAGCATCTAAGA
ACGGCACACTCTATGGAAAACCTAAAAAGGGAACTAAACCATTGCCACCCAAGAAACCCA
AAGTAGAAGGAGCTAAGAAAAAGAAGAAGGTTAACAAGAAAAAACCTGGCAGTGCTGCAG
CAAAGAAGCCAGCCAAGAAGTAA

>g6209.t33 Gene=g6209 Length=62
MIEPVFSKLKKEASKNGTLYGKPKKGTKPLPPKKPKVEGAKKKKKVNKKKPGSAAAKKPA
KK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g6209.t33 MobiDBLite mobidb-lite consensus disorder prediction 1 62 -
3 g6209.t33 MobiDBLite mobidb-lite consensus disorder prediction 1 18 -
2 g6209.t33 MobiDBLite mobidb-lite consensus disorder prediction 37 62 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed