| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6209 | g6209.t4 | TSS | g6209.t4 | 15265504 | 15265504 |
| chr_2 | g6209 | g6209.t4 | isoform | g6209.t4 | 15265527 | 15266369 |
| chr_2 | g6209 | g6209.t4 | exon | g6209.t4.exon1 | 15265527 | 15265529 |
| chr_2 | g6209 | g6209.t4 | cds | g6209.t4.CDS1 | 15265527 | 15265529 |
| chr_2 | g6209 | g6209.t4 | exon | g6209.t4.exon2 | 15265871 | 15265972 |
| chr_2 | g6209 | g6209.t4 | cds | g6209.t4.CDS2 | 15265871 | 15265972 |
| chr_2 | g6209 | g6209.t4 | exon | g6209.t4.exon3 | 15266175 | 15266369 |
| chr_2 | g6209 | g6209.t4 | cds | g6209.t4.CDS3 | 15266175 | 15266369 |
| chr_2 | g6209 | g6209.t4 | TTS | g6209.t4 | 15266763 | 15266763 |
>g6209.t4 Gene=g6209 Length=300
ATGGGTTTTACAAGATTCGTTGAAACCGGACGTATCGCACGTATTTCACGTGGACGCTAC
AAGGGAAAGCTGGTGGCGATTGTTGATGTCATTGATCAGAACAGAGTACTCATCGATGGT
CCATTGACTCGAGTTCCTCGTCAACAATATCCAGTTAGCCATTTACATCTAACAAAGTTT
GTTGTCAAATTTCCATTTACGGCACCAACACGTATTGTGAAAAAAGCTCTAGAGGATTTC
AAGATTAAAGAAAAATGGAGTCAAACACTTTGGGCAGAACGCGCAAAAGCAAAGAGATTG
>g6209.t4 Gene=g6209 Length=100
MGFTRFVETGRIARISRGRYKGKLVAIVDVIDQNRVLIDGPLTRVPRQQYPVSHLHLTKF
VVKFPFTAPTRIVKKALEDFKIKEKWSQTLWAERAKAKRL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g6209.t4 | CDD | cd06088 | KOW_RPL14 | 7 | 81 | 1.89425E-26 |
| 7 | g6209.t4 | Coils | Coil | Coil | 92 | 100 | - |
| 6 | g6209.t4 | Gene3D | G3DSA:2.30.30.30 | - | 1 | 86 | 4.4E-35 |
| 3 | g6209.t4 | PANTHER | PTHR11127:SF2 | 60S RIBOSOMAL PROTEIN L14 | 2 | 98 | 1.0E-34 |
| 4 | g6209.t4 | PANTHER | PTHR11127 | 60S RIBOSOMAL PROTEIN L14 | 2 | 98 | 1.0E-34 |
| 2 | g6209.t4 | Pfam | PF00467 | KOW motif | 10 | 39 | 3.1E-5 |
| 1 | g6209.t4 | Pfam | PF01929 | Ribosomal protein L14 | 46 | 98 | 1.0E-15 |
| 5 | g6209.t4 | SUPERFAMILY | SSF50104 | Translation proteins SH3-like domain | 5 | 95 | 4.36E-28 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0003723 | RNA binding | MF |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.