Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative 60S ribosomal protein L28.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6215 g6215.t10 TTS g6215.t10 15291317 15291317
chr_2 g6215 g6215.t10 isoform g6215.t10 15291398 15291905
chr_2 g6215 g6215.t10 exon g6215.t10.exon1 15291398 15291598
chr_2 g6215 g6215.t10 cds g6215.t10.CDS1 15291398 15291598
chr_2 g6215 g6215.t10 exon g6215.t10.exon2 15291781 15291905
chr_2 g6215 g6215.t10 cds g6215.t10.CDS2 15291781 15291894
chr_2 g6215 g6215.t10 TSS g6215.t10 15292596 15292596

Sequences

>g6215.t10 Gene=g6215 Length=326
CAAACAATTTGATGAATGTCAGCACATTCCGCTATAGTGGATTAGTTCATCCACACGCGA
TTGGTATCACACCATCAGTTGACAAGAAGGGAATCATCTTTTCATACAAAAAACCCAAAA
AATTGTATAAACCAGCTGAAAGCATTGGAAGAATCACCTTCAAATCGGGCCAGAAGCGTA
CATTGAAGAAAGTTAAGAACGTCATTCAATCAAAGAAATACCGTCGTGATTTACAACAGG
CTGCTTTGAGACGTGTCAGTGCTATCTATCGCTCACAGAAAACAAAGCCCGCTAAAAAGA
AGGGCGGCGCAAAGAAAGCCGAATAA

>g6215.t10 Gene=g6215 Length=104
MNVSTFRYSGLVHPHAIGITPSVDKKGIIFSYKKPKKLYKPAESIGRITFKSGQKRTLKK
VKNVIQSKKYRRDLQQAALRRVSAIYRSQKTKPAKKKGGAKKAE

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g6215.t10 Gene3D G3DSA:3.30.390.110 - 1 93 4.5E-28
4 g6215.t10 MobiDBLite mobidb-lite consensus disorder prediction 85 104 -
5 g6215.t10 MobiDBLite mobidb-lite consensus disorder prediction 90 104 -
2 g6215.t10 PANTHER PTHR10544:SF0 60S RIBOSOMAL PROTEIN L28 2 97 3.4E-22
3 g6215.t10 PANTHER PTHR10544 60S RIBOSOMAL PROTEIN L28 2 97 3.4E-22
1 g6215.t10 Pfam PF01778 Ribosomal L28e protein family 2 88 7.5E-18

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005840 ribosome CC
GO:0006412 translation BP
GO:0003735 structural constituent of ribosome MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values