Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6235 g6235.t1 isoform g6235.t1 15562439 15562780
chr_2 g6235 g6235.t1 exon g6235.t1.exon1 15562439 15562780
chr_2 g6235 g6235.t1 cds g6235.t1.CDS1 15562439 15562780
chr_2 g6235 g6235.t1 TSS g6235.t1 NA NA
chr_2 g6235 g6235.t1 TTS g6235.t1 NA NA

Sequences

>g6235.t1 Gene=g6235 Length=342
ATGGAACTCTTTCCTTTTTTTCTCTTTTTCTCTTTGATTGCAGGAAATCACGCTATAGGA
ACGGTGAGAAAATTTCCGACATTGCCACTGAATGCAAATGGAGTTTGGATTGATCCGACT
GGTGGTGTATGGCGACAAGCGACAGACGTTCAAAGTATTGGAACAAATGGAATGAAATCT
GAAGGAAATATTTCAACAGCAGCAGCTACTGCTCAGGCACCACAACTTCCACTTCCTGAT
TACGAAAGGTTTGCAACATTTTTCATGATTAAAAATTTTTATCCAAATTTACTGCTAAAA
AATCGAAGTGAAAATTCCGATACAATTTTTGGCCTTTTTTAA

>g6235.t1 Gene=g6235 Length=113
MELFPFFLFFSLIAGNHAIGTVRKFPTLPLNANGVWIDPTGGVWRQATDVQSIGTNGMKS
EGNISTAAATAQAPQLPLPDYERFATFFMIKNFYPNLLLKNRSENSDTIFGLF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
3 g6235.t1 Phobius SIGNAL_PEPTIDE Signal peptide region 1 18 -
4 g6235.t1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 2 -
5 g6235.t1 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 3 13 -
6 g6235.t1 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 14 18 -
2 g6235.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 19 113 -
1 g6235.t1 SignalP_EUK SignalP-noTM SignalP-noTM 1 18 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed