| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6251 | g6251.t1 | TSS | g6251.t1 | 15616922 | 15616922 |
| chr_2 | g6251 | g6251.t1 | isoform | g6251.t1 | 15616990 | 15617518 |
| chr_2 | g6251 | g6251.t1 | exon | g6251.t1.exon1 | 15616990 | 15617116 |
| chr_2 | g6251 | g6251.t1 | cds | g6251.t1.CDS1 | 15616990 | 15617116 |
| chr_2 | g6251 | g6251.t1 | exon | g6251.t1.exon2 | 15617170 | 15617227 |
| chr_2 | g6251 | g6251.t1 | cds | g6251.t1.CDS2 | 15617170 | 15617227 |
| chr_2 | g6251 | g6251.t1 | exon | g6251.t1.exon3 | 15617287 | 15617518 |
| chr_2 | g6251 | g6251.t1 | cds | g6251.t1.CDS3 | 15617287 | 15617518 |
| chr_2 | g6251 | g6251.t1 | TTS | g6251.t1 | 15617585 | 15617585 |
>g6251.t1 Gene=g6251 Length=417
ATGGATAATAACAGTGAACAGAAGCCATCAAATTTTGGTATTCACAGGCCTAAAGAGAAT
CCAAATAAAGGAGGGTCGCTCAGTGAATTTCTTCCTCAGTTAGAGAACTATTCACCAACC
ATTCCAGATGCTGTAACTTGCTATTACATGAACTCTTCAGGATTAAATTGTGCGGATCCA
AGAATAGTTCGACTAATATCAATTGCTGCACAAAAATTCATATCAGATGTAGCCAATGAT
GCTCTACAACACTGCAAAACAAAGAGTTCAGCAAATCCTAATGTAAACAAGAATCAGAAA
GATAAGGACGGCAAAAATCCAAAAGACAAAAAGTTTACTCTCACAGTTGACGATCTTGCA
CCAGCATTAAATGAAAATTATGGCATCAAGACAACTCAAATGAAATATCTCACCTAA
>g6251.t1 Gene=g6251 Length=138
MDNNSEQKPSNFGIHRPKENPNKGGSLSEFLPQLENYSPTIPDAVTCYYMNSSGLNCADP
RIVRLISIAAQKFISDVANDALQHCKTKSSANPNVNKNQKDKDGKNPKDKKFTLTVDDLA
PALNENYGIKTTQMKYLT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g6251.t1 | CDD | cd07982 | TAF10 | 26 | 130 | 1.62219E-51 |
| 7 | g6251.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 22 | - |
| 6 | g6251.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 86 | 110 | - |
| 2 | g6251.t1 | PANTHER | PTHR21242 | TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 10 | 9 | 137 | 1.3E-40 |
| 8 | g6251.t1 | PIRSF | PIRSF017246 | TFIID_TAF10 | 1 | 138 | 1.8E-47 |
| 4 | g6251.t1 | PRINTS | PR01443 | Transcription initiation factor TFIID 23-30kDa subunit signature | 39 | 55 | 7.3E-22 |
| 5 | g6251.t1 | PRINTS | PR01443 | Transcription initiation factor TFIID 23-30kDa subunit signature | 59 | 81 | 7.3E-22 |
| 3 | g6251.t1 | PRINTS | PR01443 | Transcription initiation factor TFIID 23-30kDa subunit signature | 111 | 133 | 7.3E-22 |
| 1 | g6251.t1 | Pfam | PF03540 | Transcription initiation factor TFIID 23-30kDa subunit | 39 | 88 | 1.2E-25 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005634 | nucleus | CC |
| GO:0006352 | DNA-templated transcription, initiation | BP |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.