| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6263 | g6263.t1 | TTS | g6263.t1 | 15741718 | 15741718 |
| chr_2 | g6263 | g6263.t1 | isoform | g6263.t1 | 15741784 | 15744207 |
| chr_2 | g6263 | g6263.t1 | exon | g6263.t1.exon1 | 15741784 | 15742027 |
| chr_2 | g6263 | g6263.t1 | cds | g6263.t1.CDS1 | 15741784 | 15742027 |
| chr_2 | g6263 | g6263.t1 | exon | g6263.t1.exon2 | 15744113 | 15744207 |
| chr_2 | g6263 | g6263.t1 | cds | g6263.t1.CDS2 | 15744113 | 15744207 |
| chr_2 | g6263 | g6263.t1 | TSS | g6263.t1 | NA | NA |
>g6263.t1 Gene=g6263 Length=339
ATGGAAGAATTAAGGGGAAATGGAAGCGTAAAGCGCTCATTATCAAATATTGAAATATCT
GATGACGAAGAATTTCTTGGATTTAATGCAGGCAAATGGAGACGTGCAAATAATGCAACT
GGAACATCAAATGGACACTCGAATCAACATACGATAGCAGATAATTTATCATCGGCGTCA
AGTGACGACGAAGATTTATCTCAGAAACCATTACAAATGTATCTACACCATCAGCAATAT
TACAAACAGATGAAAGAATTTCAAAAACAGCAACAACAGCAGCAGCATCAAAAAGACAAT
GACGCAAGTGATAATGAGGACAATGTTGAAGTGAATTAA
>g6263.t1 Gene=g6263 Length=112
MEELRGNGSVKRSLSNIEISDDEEFLGFNAGKWRRANNATGTSNGHSNQHTIADNLSSAS
SDDEDLSQKPLQMYLHHQQYYKQMKEFQKQQQQQQHQKDNDASDNEDNVEVN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6263.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 37 | 112 | - |
| 3 | g6263.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 37 | 67 | - |
| 1 | g6263.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 84 | 98 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed