| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6397 | g6397.t1 | TTS | g6397.t1 | 16858118 | 16858118 |
| chr_2 | g6397 | g6397.t1 | isoform | g6397.t1 | 16859131 | 16859722 |
| chr_2 | g6397 | g6397.t1 | exon | g6397.t1.exon1 | 16859131 | 16859298 |
| chr_2 | g6397 | g6397.t1 | cds | g6397.t1.CDS1 | 16859131 | 16859298 |
| chr_2 | g6397 | g6397.t1 | exon | g6397.t1.exon2 | 16859358 | 16859500 |
| chr_2 | g6397 | g6397.t1 | cds | g6397.t1.CDS2 | 16859358 | 16859500 |
| chr_2 | g6397 | g6397.t1 | exon | g6397.t1.exon3 | 16859557 | 16859722 |
| chr_2 | g6397 | g6397.t1 | cds | g6397.t1.CDS3 | 16859557 | 16859722 |
| chr_2 | g6397 | g6397.t1 | TSS | g6397.t1 | NA | NA |
>g6397.t1 Gene=g6397 Length=477
ATGCCAATGGGTCAAATGCCTGTTTTGGAAGTTGACGGAAAGCGTGTTCATCAATCACTC
GCTATGTGCCGCTATGTTGCTAAAGTCGTTGGTGTTGCTGGCAACAATCCATTCGAAGAT
TTACAAATTGATGCTATTGTTGATACCATTAATGAATTTCGTCTTAAAATTGCCATTGTC
TCATATGAGCCAGATGATGCTGTAAAAGAGAAGAAAATGATTACACTAACTCAAGAAGTT
ATCCCATTCTATTTGACAAAATTGAATGTCATTGCAAAAGAGAATGGTGGACATTTGGTG
TTAAACAGAACCACATGGGCTGATATTTATTTTGCTGGAATCATTGACTACTTGAACTAC
TTAACAAAACTTGATTTGCTTGAAAACTTCCCAAATTTGCGTGAAGTTGTCGAGAAAGTT
CTCAGCAACGAAAATATTCAGAAATATATTGCTCAGAGACCAGTCACTGAAGTATAA
>g6397.t1 Gene=g6397 Length=158
MPMGQMPVLEVDGKRVHQSLAMCRYVAKVVGVAGNNPFEDLQIDAIVDTINEFRLKIAIV
SYEPDDAVKEKKMITLTQEVIPFYLTKLNVIAKENGGHLVLNRTTWADIYFAGIIDYLNY
LTKLDLLENFPNLREVVEKVLSNENIQKYIAQRPVTEV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g6397.t1 | CDD | cd03192 | GST_C_Sigma_like | 39 | 140 | 0.0000000 |
| 7 | g6397.t1 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 1 | 151 | 0.0000000 |
| 6 | g6397.t1 | Gene3D | G3DSA:1.20.1050.10 | - | 31 | 142 | 0.0000000 |
| 2 | g6397.t1 | PANTHER | PTHR11571:SF234 | GLUTATHIONE S-TRANSFERASE S1 | 1 | 158 | 0.0000000 |
| 3 | g6397.t1 | PANTHER | PTHR11571 | GLUTATHIONE S-TRANSFERASE | 1 | 158 | 0.0000000 |
| 1 | g6397.t1 | Pfam | PF14497 | Glutathione S-transferase, C-terminal domain | 52 | 153 | 0.0000000 |
| 9 | g6397.t1 | ProSiteProfiles | PS50404 | Soluble glutathione S-transferase N-terminal domain profile. | 1 | 34 | 14.9740000 |
| 8 | g6397.t1 | ProSiteProfiles | PS50405 | Soluble glutathione S-transferase C-terminal domain profile. | 36 | 158 | 18.9940000 |
| 11 | g6397.t1 | SFLD | SFLDS00019 | Glutathione Transferase (cytosolic) | 1 | 142 | 0.0000000 |
| 4 | g6397.t1 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 1 | 30 | 0.0000005 |
| 5 | g6397.t1 | SUPERFAMILY | SSF47616 | GST C-terminal domain-like | 33 | 157 | 0.0000000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006749 | glutathione metabolic process | BP |
| GO:0005515 | protein binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed