General information for g6414.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Cell division cycle protein 23-like protein.
Parent gene
- The parent gene g6414 is located on chr_2: 16893724..16894199 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6414 | g6414.t1 | isoform | g6414.t1 | 16893724 | 16894199 |
| chr_2 | g6414 | g6414.t1 | exon | g6414.t1.exon1 | 16893724 | 16893968 |
| chr_2 | g6414 | g6414.t1 | cds | g6414.t1.CDS1 | 16893724 | 16893968 |
| chr_2 | g6414 | g6414.t1 | exon | g6414.t1.exon2 | 16894031 | 16894199 |
| chr_2 | g6414 | g6414.t1 | cds | g6414.t1.CDS2 | 16894031 | 16894199 |
| chr_2 | g6414 | g6414.t1 | TSS | g6414.t1 | NA | NA |
| chr_2 | g6414 | g6414.t1 | TTS | g6414.t1 | NA | NA |
Sequences
>g6414.t1 Gene=g6414 Length=414
ATGGCACATTTAGCTCATAAAGCAGTACAAATTAATAAATATCGACCTGAAACATGCTGC
GTCATTGGAAATTACTACAGCATACGAGGTGAACATCAGAAAGCTATTCTTTACTTTCAA
CGAGCACTCAAATTGAATCCAAAATATTTATCAGCCTGGACACTTATGGGCCACGAATTT
ATGGAACTTAAAAATACGAATGCTGCTATTCAAAGTTATAGACAAGCAGTGGAAGTTAAT
AGAAGAGATTTTCGTGCATGGTATGGTCTTGGTCAGGCATATGAAATTATTAAAATGCCA
TTTTATGGTCTTCATTATTACAAAATTGCTACTCAACTTAGACCATATGATAGTCGGATG
TTATTGCTCTTGGTGAAACATATGAGAAACTCGATAAAAAGTCTAATGCAATAA
>g6414.t1 Gene=g6414 Length=137
MAHLAHKAVQINKYRPETCCVIGNYYSIRGEHQKAILYFQRALKLNPKYLSAWTLMGHEF
MELKNTNAAIQSYRQAVEVNRRDFRAWYGLGQAYEIIKMPFYGLHYYKIATQLRPYDSRM
LLLLVKHMRNSIKSLMQ
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g6414.t1 | Gene3D | G3DSA:1.25.40.10 | - | 13 | 131 | 0.0000000 |
| 3 | g6414.t1 | PANTHER | PTHR12558:SF10 | CELL DIVISION CYCLE PROTEIN 23 HOMOLOG | 1 | 122 | 0.0000000 |
| 4 | g6414.t1 | PANTHER | PTHR12558 | CELL DIVISION CYCLE 16,23,27 | 1 | 122 | 0.0000000 |
| 1 | g6414.t1 | Pfam | PF00515 | Tetratricopeptide repeat | 17 | 49 | 0.0000000 |
| 2 | g6414.t1 | Pfam | PF13414 | TPR repeat | 57 | 94 | 0.0000000 |
| 13 | g6414.t1 | ProSiteProfiles | PS50293 | TPR repeat region circular profile. | 1 | 117 | 21.9260000 |
| 12 | g6414.t1 | ProSiteProfiles | PS50005 | TPR repeat profile. | 16 | 49 | 11.2400000 |
| 11 | g6414.t1 | ProSiteProfiles | PS50005 | TPR repeat profile. | 50 | 83 | 10.0300000 |
| 10 | g6414.t1 | ProSiteProfiles | PS50005 | TPR repeat profile. | 84 | 117 | 6.2250000 |
| 8 | g6414.t1 | SMART | SM00028 | tpr_5 | 16 | 49 | 0.0000018 |
| 7 | g6414.t1 | SMART | SM00028 | tpr_5 | 50 | 83 | 0.0035000 |
| 6 | g6414.t1 | SMART | SM00028 | tpr_5 | 84 | 117 | 10.0000000 |
| 5 | g6414.t1 | SUPERFAMILY | SSF48452 | TPR-like | 7 | 124 | 0.0000000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
