General information for g6415.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g6415 is located on chr_2: 16895139..16896559 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6415 | g6415.t1 | isoform | g6415.t1 | 16894674 | 16895139 |
| chr_2 | g6415 | g6415.t1 | exon | g6415.t1.exon1 | 16894674 | 16894894 |
| chr_2 | g6415 | g6415.t1 | cds | g6415.t1.CDS1 | 16894674 | 16894894 |
| chr_2 | g6415 | g6415.t1 | exon | g6415.t1.exon2 | 16894966 | 16894992 |
| chr_2 | g6415 | g6415.t1 | cds | g6415.t1.CDS2 | 16894966 | 16894992 |
| chr_2 | g6415 | g6415.t1 | exon | g6415.t1.exon3 | 16895046 | 16895139 |
| chr_2 | g6415 | g6415.t1 | cds | g6415.t1.CDS3 | 16895046 | 16895139 |
| chr_2 | g6415 | g6415.t1 | TSS | g6415.t1 | NA | NA |
| chr_2 | g6415 | g6415.t1 | TTS | g6415.t1 | NA | NA |
Sequences
>g6415.t1 Gene=g6415 Length=342
ATGGTCGATTTAATGAATTTTAATCTGGTAGAAGTTAAACAGGATTTAATTAAGGGTATT
ATAGAATGTAATAAGCGTGGATTAATTCATTCGAGTAAATGGCTTGCAGAATTAAATCAA
GAATTTGATAGCTATATGCTTGCAAAGACATATTTTGATTGTCGTGAATATGACAGAGCG
GCTTATTTCACTCGAAATTCAATATCACCAGTTCCTCGCTTCATTTATCTCTATTCAATG
TATATGGCAAAGGAGAAGAAACGATTAGATAATTCACCAGATAATGCAACTCTTCTCACT
GGAAATGCTCATCTCAAAGATCTTAGTGAATTAATGTCCTAA
>g6415.t1 Gene=g6415 Length=113
MVDLMNFNLVEVKQDLIKGIIECNKRGLIHSSKWLAELNQEFDSYMLAKTYFDCREYDRA
AYFTRNSISPVPRFIYLYSMYMAKEKKRLDNSPDNATLLTGNAHLKDLSELMS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g6415.t1 | Gene3D | G3DSA:1.25.40.10 | - | 7 | 113 | 0 |
| 2 | g6415.t1 | PANTHER | PTHR12558:SF10 | CELL DIVISION CYCLE PROTEIN 23 HOMOLOG | 8 | 98 | 0 |
| 3 | g6415.t1 | PANTHER | PTHR12558 | CELL DIVISION CYCLE 16,23,27 | 8 | 98 | 0 |
| 1 | g6415.t1 | Pfam | PF04049 | Anaphase promoting complex subunit 8 / Cdc23 | 39 | 92 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
| GO:0030071 | regulation of mitotic metaphase/anaphase transition | BP |
| GO:0005680 | anaphase-promoting complex | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed