Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6430 g6430.t2 TSS g6430.t2 17043834 17043834
chr_2 g6430 g6430.t2 isoform g6430.t2 17043854 17044537
chr_2 g6430 g6430.t2 exon g6430.t2.exon1 17043854 17043911
chr_2 g6430 g6430.t2 cds g6430.t2.CDS1 17043854 17043911
chr_2 g6430 g6430.t2 exon g6430.t2.exon2 17043968 17043989
chr_2 g6430 g6430.t2 cds g6430.t2.CDS2 17043968 17043989
chr_2 g6430 g6430.t2 exon g6430.t2.exon3 17044046 17044155
chr_2 g6430 g6430.t2 cds g6430.t2.CDS3 17044046 17044155
chr_2 g6430 g6430.t2 exon g6430.t2.exon4 17044214 17044399
chr_2 g6430 g6430.t2 cds g6430.t2.CDS4 17044214 17044399
chr_2 g6430 g6430.t2 exon g6430.t2.exon5 17044461 17044537
chr_2 g6430 g6430.t2 cds g6430.t2.CDS5 17044461 17044537
chr_2 g6430 g6430.t2 TTS g6430.t2 NA NA

Sequences

>g6430.t2 Gene=g6430 Length=453
ATGAAATATTTGGCTATTGCAATAATTTATGCCTTTGTATCCATCACAATGGCTCAAAAA
CGGGTTGTCTGCTATTTTCCCTCATGGACAAGCATTAATCCAAATCCATCAATTTGTACA
CATTTGATTTATTCATTCCTTAATATTGGTGCTGATGGTTCTATTGTGCCATTTGATGCA
TCAGGATTTAGTCTAACTGCATTTACTGGATTACGTTCACAAAATTCAGCTTTAAAAGTC
ATTTTGGGAATTGGTGGAGCAACAGCATCAAATTTTGGACCTGTTGCAGCTAATAATGCA
TTGATAAATATATTTGCTAATAATGTTGCTCAAATCATCAATACTTATGGCTTTGATGGC
GTTGATATTGATTGGGAATATCCAAGTGTTAATGAAAATTTCATTGGACTTTTAACTGCT
GTTCGTAATGCATTGCCCAATGGAAAAATTCTT

>g6430.t2 Gene=g6430 Length=151
MKYLAIAIIYAFVSITMAQKRVVCYFPSWTSINPNPSICTHLIYSFLNIGADGSIVPFDA
SGFSLTAFTGLRSQNSALKVILGIGGATASNFGPVAANNALINIFANNVAQIINTYGFDG
VDIDWEYPSVNENFIGLLTAVRNALPNGKIL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
6 g6430.t2 Gene3D G3DSA:3.20.20.80 Glycosidases 1 151 5.3E-39
2 g6430.t2 PANTHER PTHR11177 CHITINASE 19 145 1.1E-24
1 g6430.t2 Pfam PF00704 Glycosyl hydrolases family 18 21 146 6.0E-29
8 g6430.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 18 -
9 g6430.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 3 -
10 g6430.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 4 13 -
11 g6430.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 14 18 -
7 g6430.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 19 151 -
4 g6430.t2 ProSitePatterns PS01095 Chitinases family 18 active site. 118 126 -
3 g6430.t2 SUPERFAMILY SSF51445 (Trans)glycosidases 18 149 2.88E-36
5 g6430.t2 SignalP_EUK SignalP-noTM SignalP-noTM 1 18 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds MF
GO:0005975 carbohydrate metabolic process BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed