Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6445 g6445.t2 TSS g6445.t2 17086405 17086405
chr_2 g6445 g6445.t2 isoform g6445.t2 17086529 17087329
chr_2 g6445 g6445.t2 exon g6445.t2.exon1 17086529 17086539
chr_2 g6445 g6445.t2 exon g6445.t2.exon2 17086864 17086939
chr_2 g6445 g6445.t2 cds g6445.t2.CDS1 17086889 17086939
chr_2 g6445 g6445.t2 exon g6445.t2.exon3 17086998 17087329
chr_2 g6445 g6445.t2 cds g6445.t2.CDS2 17086998 17087327
chr_2 g6445 g6445.t2 TTS g6445.t2 NA NA

Sequences

>g6445.t2 Gene=g6445 Length=419
ACTAGAGGCAAAGTACAACTCAAATTGAATATAGATATGAATCCTTATGGACAACAGCAA
CCACCACAACAAGGATGGCCTGGAAATATCAATCAGCAAATGGCAAATATGAATTTAGGA
CCACCTAAGCCACAACAACAACAATTAGGAAATCCCCAGATGATGAGTCAAATTCCACCT
CAATCATTTGCAATGAATAACAACAATCAACTTCCACCACCATCATCAACACCACAAATG
ATGAATCCTCCTCCTCCTTCTGCTGCTGCGACAATACCGAATAATAATAACAATATGAAT
GTGAACAACAACAATAATCAATTTCCGCCACCAATGGGTCAAACAAATGGCATGCAAAAT
GGTTCACAATTTCCACCAGTGATGGCAAATAAAACAACTGTACCAAGTCAATTTCCACC

>g6445.t2 Gene=g6445 Length=127
MNPYGQQQPPQQGWPGNINQQMANMNLGPPKPQQQQLGNPQMMSQIPPQSFAMNNNNQLP
PPSSTPQMMNPPPPSAAATIPNNNNNMNVNNNNNQFPPPMGQTNGMQNGSQFPPVMANKT
TVPSQFP

Protein features from InterProScan

Transcript Database ID Name Start End E.value
1 g6445.t2 MobiDBLite mobidb-lite consensus disorder prediction 1 127 -
3 g6445.t2 MobiDBLite mobidb-lite consensus disorder prediction 1 63 -
4 g6445.t2 MobiDBLite mobidb-lite consensus disorder prediction 64 78 -
2 g6445.t2 MobiDBLite mobidb-lite consensus disorder prediction 79 127 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values