| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g65 | g65.t1 | isoform | g65.t1 | 471047 | 471740 |
| chr_3 | g65 | g65.t1 | exon | g65.t1.exon1 | 471047 | 471285 |
| chr_3 | g65 | g65.t1 | cds | g65.t1.CDS1 | 471047 | 471285 |
| chr_3 | g65 | g65.t1 | exon | g65.t1.exon2 | 471695 | 471740 |
| chr_3 | g65 | g65.t1 | cds | g65.t1.CDS2 | 471695 | 471740 |
| chr_3 | g65 | g65.t1 | TSS | g65.t1 | NA | NA |
| chr_3 | g65 | g65.t1 | TTS | g65.t1 | NA | NA |
>g65.t1 Gene=g65 Length=285
ATGCAAATCTTTGTCAAGACTCTTACTGGACCAGTACATTCAGTCGTTTGCTCATCAGGA
GATACAATTATGAGTGTCAAGGAACAATTGGAGAAGAAATATGAAGAAGGCATGCCACCA
AATCAGCAACGTCTTATCTATGCTGGAAAGAACCTTGAAGACAACCGCACTCTTGCAGAT
TACAACATCTTACATAACACAACTGTTCATATCGTGCTGAGACTTCGTGGTGGTCAACAA
TCAATTTTAGACAAGTCATTTGAATGTCAAGTTGAAGTCAAGTAA
>g65.t1 Gene=g65 Length=94
MQIFVKTLTGPVHSVVCSSGDTIMSVKEQLEKKYEEGMPPNQQRLIYAGKNLEDNRTLAD
YNILHNTTVHIVLRLRGGQQSILDKSFECQVEVK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g65.t1 | Gene3D | G3DSA:3.10.20.90 | - | 1 | 92 | 0.0000000 |
| 2 | g65.t1 | PANTHER | PTHR10666 | UBIQUITIN | 1 | 81 | 0.0000000 |
| 3 | g65.t1 | PANTHER | PTHR10666:SF364 | - | 1 | 81 | 0.0000000 |
| 4 | g65.t1 | PRINTS | PR00348 | Ubiquitin signature | 11 | 31 | 0.0000001 |
| 5 | g65.t1 | PRINTS | PR00348 | Ubiquitin signature | 55 | 76 | 0.0000001 |
| 1 | g65.t1 | Pfam | PF00240 | Ubiquitin family | 3 | 76 | 0.0000000 |
| 9 | g65.t1 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 1 | 78 | 25.3130000 |
| 7 | g65.t1 | SMART | SM00213 | ubq_7 | 1 | 74 | 0.0000000 |
| 6 | g65.t1 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 1 | 79 | 0.0000000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005515 | protein binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed