General information for g6506.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Translocon-associated protein subunit gamma.
Parent gene
- The parent gene g6506 is located on chr_2: 17323115..17323836 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6506 | g6506.t1 | TTS | g6506.t1 | 17322930 | 17322930 |
| chr_2 | g6506 | g6506.t1 | isoform | g6506.t1 | 17323115 | 17323836 |
| chr_2 | g6506 | g6506.t1 | exon | g6506.t1.exon1 | 17323115 | 17323533 |
| chr_2 | g6506 | g6506.t1 | cds | g6506.t1.CDS1 | 17323115 | 17323533 |
| chr_2 | g6506 | g6506.t1 | exon | g6506.t1.exon2 | 17323701 | 17323836 |
| chr_2 | g6506 | g6506.t1 | cds | g6506.t1.CDS2 | 17323701 | 17323836 |
| chr_2 | g6506 | g6506.t1 | TSS | g6506.t1 | 17323893 | 17323893 |
Sequences
>g6506.t1 Gene=g6506 Length=555
ATGGTTCAAGAAAAGAAATCAGCTATGTTTACAAAGGAAGAAGAGCTCCTTTTACAGGAT
TTTAATAGAAATGTATCAACTGGCTCAAATATGCTTTTTTACGGCGCGAGCTTCATAACA
TCAGCTTTGCCAATCTGGCTCTATTGGAGAATTCATCAAATTGAATTATTCTCTTCACTC
ATCTTTTTTGTTGCATTAACTGCTTTGAGCACCTACTTGCTATCAATGGCCTACAGAAAC
ACCAAATTCACTCTTAAGCATAAAGTTGCAATCAAACGTGAAGATGCTGTAACTCGTGAA
ATGACACAATTATTGGCTGATGATAAAATGTCACGAAAAGAAAAGGATGAAAGAATTTTG
TGGAAGAAAAATGAAGTTGCTGATTTTGAAGCTACTGTTTTCTCAATCTTCTATAACAAT
GCACTTTTCTTAGCAATTACCATCTTCTTAAGCTTCTACTTGCTTCGTCAAATCTCACCA
TTATTCAACTATATTATCACAATTGCTGGAACATCAGGACTTTTAGCATTGCTCTCAACC
AGCAAGTCAACATAA
>g6506.t1 Gene=g6506 Length=184
MVQEKKSAMFTKEEELLLQDFNRNVSTGSNMLFYGASFITSALPIWLYWRIHQIELFSSL
IFFVALTALSTYLLSMAYRNTKFTLKHKVAIKREDAVTREMTQLLADDKMSRKEKDERIL
WKKNEVADFEATVFSIFYNNALFLAITIFLSFYLLRQISPLFNYIITIAGTSGLLALLST
SKST
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6506.t1 | PANTHER | PTHR13399 | TRANSLOCON-ASSOCIATED PROTEIN TRAP , GAMMA SUBUNIT | 6 | 182 | 7.6E-76 |
| 1 | g6506.t1 | Pfam | PF07074 | Translocon-associated protein, gamma subunit (TRAP-gamma) | 13 | 181 | 2.9E-79 |
| 8 | g6506.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 30 | - |
| 13 | g6506.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 31 | 51 | - |
| 10 | g6506.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 52 | 56 | - |
| 14 | g6506.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 57 | 78 | - |
| 7 | g6506.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 79 | 130 | - |
| 12 | g6506.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 155 | - |
| 11 | g6506.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 156 | 160 | - |
| 15 | g6506.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 161 | 178 | - |
| 9 | g6506.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 179 | 184 | - |
| 4 | g6506.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 49 | - |
| 5 | g6506.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 78 | - |
| 3 | g6506.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 132 | 154 | - |
| 6 | g6506.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 161 | 180 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006614 | SRP-dependent cotranslational protein targeting to membrane | BP |
| GO:0016021 | integral component of membrane | CC |
KEGG
Orthology
- This transcript has been annotated with K13251 (translocon-associated protein subunit gamma)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
