| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6506 | g6506.t9 | TTS | g6506.t9 | 17322930 | 17322930 |
| chr_2 | g6506 | g6506.t9 | isoform | g6506.t9 | 17323115 | 17323836 |
| chr_2 | g6506 | g6506.t9 | exon | g6506.t9.exon1 | 17323115 | 17323533 |
| chr_2 | g6506 | g6506.t9 | cds | g6506.t9.CDS1 | 17323115 | 17323444 |
| chr_2 | g6506 | g6506.t9 | exon | g6506.t9.exon2 | 17323711 | 17323836 |
| chr_2 | g6506 | g6506.t9 | TSS | g6506.t9 | 17323893 | 17323893 |
>g6506.t9 Gene=g6506 Length=545
ATGGTTCAAGAAAAGAAATCAGCTATGTTTACAAAGGAAGAAGAGCTCCTTTTACAGGAT
TTTAATAGAAATGTATCAACTGGCTCAAATATGCTTTTTTACGGCGCGAGCTTCATAACA
TCAGCTGGCTCTATTGGAGAATTCATCAAATTGAATTATTCTCTTCACTCATCTTTTTTG
TTGCATTAACTGCTTTGAGCACCTACTTGCTATCAATGGCCTACAGAAACACCAAATTCA
CTCTTAAGCATAAAGTTGCAATCAAACGTGAAGATGCTGTAACTCGTGAAATGACACAAT
TATTGGCTGATGATAAAATGTCACGAAAAGAAAAGGATGAAAGAATTTTGTGGAAGAAAA
ATGAAGTTGCTGATTTTGAAGCTACTGTTTTCTCAATCTTCTATAACAATGCACTTTTCT
TAGCAATTACCATCTTCTTAAGCTTCTACTTGCTTCGTCAAATCTCACCATTATTCAACT
ATATTATCACAATTGCTGGAACATCAGGACTTTTAGCATTGCTCTCAACCAGCAAGTCAA
CATAA
>g6506.t9 Gene=g6506 Length=109
MAYRNTKFTLKHKVAIKREDAVTREMTQLLADDKMSRKEKDERILWKKNEVADFEATVFS
IFYNNALFLAITIFLSFYLLRQISPLFNYIITIAGTSGLLALLSTSKST
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6506.t9 | PANTHER | PTHR13399 | TRANSLOCON-ASSOCIATED PROTEIN TRAP , GAMMA SUBUNIT | 1 | 107 | 3.1E-47 |
| 1 | g6506.t9 | Pfam | PF07074 | Translocon-associated protein, gamma subunit (TRAP-gamma) | 1 | 106 | 3.6E-50 |
| 5 | g6506.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 55 | - |
| 9 | g6506.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 80 | - |
| 7 | g6506.t9 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 81 | 85 | - |
| 8 | g6506.t9 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 86 | 103 | - |
| 6 | g6506.t9 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 104 | 109 | - |
| 4 | g6506.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 58 | 80 | - |
| 3 | g6506.t9 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 85 | 104 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006614 | SRP-dependent cotranslational protein targeting to membrane | BP |
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed