| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6545 | g6545.t5 | TSS | g6545.t5 | 17574793 | 17574793 |
| chr_2 | g6545 | g6545.t5 | isoform | g6545.t5 | 17575305 | 17575805 |
| chr_2 | g6545 | g6545.t5 | exon | g6545.t5.exon1 | 17575305 | 17575805 |
| chr_2 | g6545 | g6545.t5 | cds | g6545.t5.CDS1 | 17575312 | 17575695 |
| chr_2 | g6545 | g6545.t5 | TTS | g6545.t5 | 17575799 | 17575799 |
>g6545.t5 Gene=g6545 Length=501
GGATCCAATGGTTTTATCAGTTTTATACATTTGGTGTCAACTTAATAAAGAGATTATTGT
AACATTTTGGTTTGGTAGCAGATTTAAAGCAATGTATCTTCCGTGGGTACTTTTTGCCTT
CAATGTTTTATTATCAAATGGTGGAATGCTTTCACTTTTTGGTATTTTGATCGGACATCT
TTACTTTTTCCTTAAATTTACATATCCACTAGAACTGAATGGGTCAGATTTTTTGAAAAC
ACCTCAATTTATAAAGAATTATCTTCCTGATGTTAGACCATCTGGCGTTTTTGGATTTGC
ACCAGAAGGCCGAACAACACAACACAATGAACCACAAAGAAGAACTGGTACACTTTTTGG
TGGTGCAGGACATAGATTGGGCAATAATTAAAATAATTAATATCGATCGCTTATATTAAT
TCCTTCGATCCTGAAAGATTTTTTAATATTTCTTTTTTCATTTATTTGAAATAAAAGAAC
ATAAAATATTTTATGTAAAAA
>g6545.t5 Gene=g6545 Length=127
MVLSVLYIWCQLNKEIIVTFWFGSRFKAMYLPWVLFAFNVLLSNGGMLSLFGILIGHLYF
FLKFTYPLELNGSDFLKTPQFIKNYLPDVRPSGVFGFAPEGRTTQHNEPQRRTGTLFGGA
GHRLGNN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g6545.t5 | PANTHER | PTHR11009 | DER1-LIKE PROTEIN, DERLIN | 1 | 111 | 3.8E-32 |
| 3 | g6545.t5 | PANTHER | PTHR11009:SF1 | DERLIN-1 | 1 | 111 | 3.8E-32 |
| 1 | g6545.t5 | Pfam | PF04511 | Der1-like family | 1 | 80 | 1.8E-28 |
| 6 | g6545.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 29 | - |
| 7 | g6545.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 30 | 62 | - |
| 5 | g6545.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 63 | 127 | - |
| 4 | g6545.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 33 | 55 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.