General information for g6609.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g6609 is located on chr_2: 17794480..17794762 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6609 | g6609.t1 | TSS | g6609.t1 | 17794463 | 17794463 |
| chr_2 | g6609 | g6609.t1 | isoform | g6609.t1 | 17794480 | 17794762 |
| chr_2 | g6609 | g6609.t1 | exon | g6609.t1.exon1 | 17794480 | 17794581 |
| chr_2 | g6609 | g6609.t1 | cds | g6609.t1.CDS1 | 17794480 | 17794581 |
| chr_2 | g6609 | g6609.t1 | exon | g6609.t1.exon2 | 17794643 | 17794762 |
| chr_2 | g6609 | g6609.t1 | cds | g6609.t1.CDS2 | 17794643 | 17794762 |
| chr_2 | g6609 | g6609.t1 | TTS | g6609.t1 | 17794823 | 17794823 |
Sequences
>g6609.t1 Gene=g6609 Length=222
ATGGCAAAGTCAAAGAATCATACCAATCACAACCAAAATCAAAAGGCTCATAAAAATGGC
ATCACTCGCCCATCCCGAAAACGTCATGAGTCGACTCTTGGTATGGATGCCAAATTCCTT
CGCAACCTTCGTTTCTCAAAGAAAAATAACTTGAGCCGTGAAGATGCCGAAAAACGAGCC
CAAGAAAATAAGGATAAGAAGCGTAAATCAATCAAGTTGTAA
>g6609.t1 Gene=g6609 Length=73
MAKSKNHTNHNQNQKAHKNGITRPSRKRHESTLGMDAKFLRNLRFSKKNNLSREDAEKRA
QENKDKKRKSIKL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g6609.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 19 | - |
| 6 | g6609.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 73 | - |
| 4 | g6609.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 25 | 73 | - |
| 2 | g6609.t1 | PANTHER | PTHR12884:SF0 | 60S RIBOSOMAL PROTEIN L29 | 1 | 67 | 1.0E-22 |
| 3 | g6609.t1 | PANTHER | PTHR12884 | 60S RIBOSOMAL PROTEIN L29 | 1 | 67 | 1.0E-22 |
| 1 | g6609.t1 | Pfam | PF01779 | Ribosomal L29e protein family | 3 | 42 | 1.6E-19 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
KEGG
Orthology
- This transcript has been annotated with K02905 (large subunit ribosomal protein L29e)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
