| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g674 | g674.t2 | TTS | g674.t2 | 5209165 | 5209165 |
| chr_3 | g674 | g674.t2 | isoform | g674.t2 | 5209193 | 5210514 |
| chr_3 | g674 | g674.t2 | exon | g674.t2.exon1 | 5209193 | 5209251 |
| chr_3 | g674 | g674.t2 | cds | g674.t2.CDS1 | 5209227 | 5209251 |
| chr_3 | g674 | g674.t2 | exon | g674.t2.exon2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t2 | cds | g674.t2.CDS2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t2 | exon | g674.t2.exon3 | 5210295 | 5210514 |
| chr_3 | g674 | g674.t2 | cds | g674.t2.CDS3 | 5210295 | 5210506 |
| chr_3 | g674 | g674.t2 | TSS | g674.t2 | 5211298 | 5211298 |
>g674.t2 Gene=g674 Length=498
GAACTTGGATGACAATAATTGCTTGGATGATAATTTTGGTAGTGTCAATTTATTGGGCCC
ATAAATTAATTAGTGGAAATCCAATGAAAACAGTAGAATTGGCATTCAAACATTGCAAAG
ATCCACTCTATCCTAAGCCTGAAACTACTGTCGTTTTTTCTGCTCTCCGATGCATTGCGA
TGTCTTGTGGAATTTTGTTAAATGCACCAATTTACAAAAGAGAGTCAAAATTGAAATTCT
TTGAATCAGCAGTAATGACAATATGTTTAATTATTCTTCAATTCTGTGCAATTTATGAAA
CACCAAAGAATTACAAAATTATCATTTTCTATAGTTATTCATTTATTATTTATGCATTTT
TCCAATTTATGTTCATCTATTTTGTTCCAAAAATTGCAACAATAACTAATGAAAATTCTC
AAGAAAAAGTCAAAAATCAAATTAAATGTTTAACGTATTTATAGAAAAATTCAAATAAAA
CCATATAAATGTTAAAAA
>g674.t2 Gene=g674 Length=151
MTIIAWMIILVVSIYWAHKLISGNPMKTVELAFKHCKDPLYPKPETTVVFSALRCIAMSC
GILLNAPIYKRESKLKFFESAVMTICLIILQFCAIYETPKNYKIIIFYSYSFIIYAFFQF
MFIYFVPKIATITNENSQEKVKNQIKCLTYL
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g674.t2 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 19 | - |
| 11 | g674.t2 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 2 | - |
| 12 | g674.t2 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 3 | 14 | - |
| 16 | g674.t2 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 15 | 19 | - |
| 9 | g674.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 20 | 47 | - |
| 13 | g674.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 69 | - |
| 7 | g674.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 70 | 80 | - |
| 15 | g674.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 81 | 99 | - |
| 8 | g674.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 100 | 104 | - |
| 14 | g674.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 126 | - |
| 6 | g674.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 127 | 151 | - |
| 5 | g674.t2 | SignalP_EUK | SignalP-TM | SignalP-TM | 1 | 22 | - |
| 2 | g674.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 2 | 21 | - |
| 3 | g674.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 1 | g674.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 75 | 94 | - |
| 4 | g674.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 104 | 126 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed