Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_3 g674 g674.t2 TTS g674.t2 5209165 5209165
chr_3 g674 g674.t2 isoform g674.t2 5209193 5210514
chr_3 g674 g674.t2 exon g674.t2.exon1 5209193 5209251
chr_3 g674 g674.t2 cds g674.t2.CDS1 5209227 5209251
chr_3 g674 g674.t2 exon g674.t2.exon2 5210021 5210239
chr_3 g674 g674.t2 cds g674.t2.CDS2 5210021 5210239
chr_3 g674 g674.t2 exon g674.t2.exon3 5210295 5210514
chr_3 g674 g674.t2 cds g674.t2.CDS3 5210295 5210506
chr_3 g674 g674.t2 TSS g674.t2 5211298 5211298

Sequences

>g674.t2 Gene=g674 Length=498
GAACTTGGATGACAATAATTGCTTGGATGATAATTTTGGTAGTGTCAATTTATTGGGCCC
ATAAATTAATTAGTGGAAATCCAATGAAAACAGTAGAATTGGCATTCAAACATTGCAAAG
ATCCACTCTATCCTAAGCCTGAAACTACTGTCGTTTTTTCTGCTCTCCGATGCATTGCGA
TGTCTTGTGGAATTTTGTTAAATGCACCAATTTACAAAAGAGAGTCAAAATTGAAATTCT
TTGAATCAGCAGTAATGACAATATGTTTAATTATTCTTCAATTCTGTGCAATTTATGAAA
CACCAAAGAATTACAAAATTATCATTTTCTATAGTTATTCATTTATTATTTATGCATTTT
TCCAATTTATGTTCATCTATTTTGTTCCAAAAATTGCAACAATAACTAATGAAAATTCTC
AAGAAAAAGTCAAAAATCAAATTAAATGTTTAACGTATTTATAGAAAAATTCAAATAAAA
CCATATAAATGTTAAAAA

>g674.t2 Gene=g674 Length=151
MTIIAWMIILVVSIYWAHKLISGNPMKTVELAFKHCKDPLYPKPETTVVFSALRCIAMSC
GILLNAPIYKRESKLKFFESAVMTICLIILQFCAIYETPKNYKIIIFYSYSFIIYAFFQF
MFIYFVPKIATITNENSQEKVKNQIKCLTYL

Protein features from InterProScan

Transcript Database ID Name Start End E.value
10 g674.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 19 -
11 g674.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 2 -
12 g674.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 3 14 -
16 g674.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 15 19 -
9 g674.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 20 47 -
13 g674.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 48 69 -
7 g674.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 70 80 -
15 g674.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 81 99 -
8 g674.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 100 104 -
14 g674.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 105 126 -
6 g674.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 127 151 -
5 g674.t2 SignalP_EUK SignalP-TM SignalP-TM 1 22 -
2 g674.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 2 21 -
3 g674.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 46 68 -
1 g674.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 75 94 -
4 g674.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 104 126 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed