General information for g674.t27
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glucose-6-phosphatase.
Parent gene
- The parent gene g674 is located on chr_3: 5210514..5211200 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g674 | g674.t27 | TTS | g674.t27 | 5209165 | 5209165 |
| chr_3 | g674 | g674.t27 | isoform | g674.t27 | 5209193 | 5211200 |
| chr_3 | g674 | g674.t27 | exon | g674.t27.exon1 | 5209193 | 5209250 |
| chr_3 | g674 | g674.t27 | cds | g674.t27.CDS1 | 5209238 | 5209250 |
| chr_3 | g674 | g674.t27 | exon | g674.t27.exon2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t27 | cds | g674.t27.CDS2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t27 | exon | g674.t27.exon3 | 5210295 | 5211074 |
| chr_3 | g674 | g674.t27 | cds | g674.t27.CDS3 | 5210295 | 5211074 |
| chr_3 | g674 | g674.t27 | exon | g674.t27.exon4 | 5211139 | 5211200 |
| chr_3 | g674 | g674.t27 | cds | g674.t27.CDS4 | 5211139 | 5211200 |
| chr_3 | g674 | g674.t27 | TSS | g674.t27 | 5211298 | 5211298 |
Sequences
>g674.t27 Gene=g674 Length=1119
ATGGAGATAATTGACAGCTTATGGAAAATAGAAATCGATTTAATTATTAAAATTCAAAAC
AAGTTTTTCAAATATGAAGAATTTCTCGGATATTTTTCAACATTTTTTGGTTCGGGATAT
CTCCACTTGTACATTATTCCATTGTTTGCAATGTACAACACAAAAGTTTATCATCGTTTA
TTGATTTCATGCATTGCGACTGATTTTATTAATCTCATTATAAAATGGATTTTAGATGAA
GATCGACCTTACTGGTGGGTCAATGAAACAAAAGCTTACACATCACTCACCCGACCAATA
TTATATCAAACTGAAAGAACTTGTGAGACATCGGGTGGATCACCATCAGGTCATTCGATG
ATTGCTGCATGTTTTCTATACATCATCTATGACGAAATCAACCGACAAATCGACAATCGT
CCTTCAATGTCGCACAAAGTCATACTGAAAATTCTAAACAAAATTGGACTGACTTTTATA
CTTACAATTACTGCCATATCGAGAATGTACTTTGCTGCACATTTTTTGCATCAATGTATT
TTAGGTTTCATGCTTGGACTTTTAGTAGCAAATTTAATGGCAAATCATGGATTGGCTGAA
AAATTTTCGAGTTTTGAAAAACGAACTTGGATGACAATAATTGCTTGGATGATAATTTTG
GTAGTGTCAATTTATTGGGCCCATAAATTAATTAGTGGAAATCCAATGAAAACAGTAGAA
TTGGCATTCAAACATTGCAAAGATCCACTCTATCCTAAGCCTGAAACTACTGTCGTTTTT
TCTGCTCTCCGATGCATTGCGATGTCTTGTGGAATTTTGTTAAATGCACCAATTTACAAA
AGAGAGTCAAAATTGAAATTCTTTGAATCAGCAGTAATGACAATATGTTTAATTATTCTT
CAATTCTGTGCAATTTATGAAACACCAAAGAATTACAAAATTATCATTTTCTATAGTTAT
TCATTTATTATTTATGCATTTTTCCAATTTATGTTCATCTATTTTGTTCCAAAAATTGCA
ACAATAACTAATGAAAATTCTCAAGAAAAAGTCAAAAATCAATTAAATGTTTAACGTATT
TATAGAAAAATTCAAATAAAACCATATAAATGTTAAAAA
>g674.t27 Gene=g674 Length=357
MEIIDSLWKIEIDLIIKIQNKFFKYEEFLGYFSTFFGSGYLHLYIIPLFAMYNTKVYHRL
LISCIATDFINLIIKWILDEDRPYWWVNETKAYTSLTRPILYQTERTCETSGGSPSGHSM
IAACFLYIIYDEINRQIDNRPSMSHKVILKILNKIGLTFILTITAISRMYFAAHFLHQCI
LGFMLGLLVANLMANHGLAEKFSSFEKRTWMTIIAWMIILVVSIYWAHKLISGNPMKTVE
LAFKHCKDPLYPKPETTVVFSALRCIAMSCGILLNAPIYKRESKLKFFESAVMTICLIIL
QFCAIYETPKNYKIIIFYSYSFIIYAFFQFMFIYFVPKIATITNENSQEKVKNQLNV
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g674.t27 | Gene3D | G3DSA:1.20.144.10 | - | 3 | 212 | 9.9E-14 |
| 2 | g674.t27 | PANTHER | PTHR12591 | GLUCOSE-6-PHOSPHATASE | 4 | 348 | 4.1E-67 |
| 3 | g674.t27 | PANTHER | PTHR12591:SF0 | FI19814P1 | 4 | 348 | 4.1E-67 |
| 25 | g674.t27 | PIRSF | PIRSF000905 | G6Pase | 4 | 352 | 1.4E-51 |
| 1 | g674.t27 | Pfam | PF01569 | PAP2 superfamily | 60 | 194 | 1.7E-20 |
| 12 | g674.t27 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 27 | - |
| 19 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 28 | 48 | - |
| 6 | g674.t27 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 49 | 59 | - |
| 21 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 60 | 78 | - |
| 13 | g674.t27 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 79 | 111 | - |
| 24 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 112 | 130 | - |
| 8 | g674.t27 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 131 | 150 | - |
| 20 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 151 | 169 | - |
| 11 | g674.t27 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 170 | 174 | - |
| 22 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 175 | 198 | - |
| 7 | g674.t27 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 199 | 209 | - |
| 17 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 210 | 228 | - |
| 14 | g674.t27 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 229 | 257 | - |
| 23 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 258 | 279 | - |
| 9 | g674.t27 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 280 | 290 | - |
| 16 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 291 | 309 | - |
| 15 | g674.t27 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 310 | 314 | - |
| 18 | g674.t27 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 315 | 336 | - |
| 10 | g674.t27 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 337 | 357 | - |
| 32 | g674.t27 | SMART | SM00014 | acid_phosph_2 | 55 | 194 | 2.6E-15 |
| 4 | g674.t27 | SUPERFAMILY | SSF48317 | Acid phosphatase/Vanadium-dependent haloperoxidase | 28 | 193 | 1.14E-14 |
| 27 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 29 | 51 | - |
| 31 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 78 | - |
| 29 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 172 | 194 | - |
| 28 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 209 | 228 | - |
| 26 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 287 | 309 | - |
| 30 | g674.t27 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 314 | 336 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004346 | glucose-6-phosphatase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K01084 (glucose-6-phosphatase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed