General information for g674.t37
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Glucose-6-phosphatase.
Parent gene
- The parent gene g674 is located on chr_3: 5210514..5211200 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g674 | g674.t37 | TTS | g674.t37 | 5209165 | 5209165 |
| chr_3 | g674 | g674.t37 | isoform | g674.t37 | 5209193 | 5211200 |
| chr_3 | g674 | g674.t37 | exon | g674.t37.exon1 | 5209193 | 5209249 |
| chr_3 | g674 | g674.t37 | cds | g674.t37.CDS1 | 5209246 | 5209249 |
| chr_3 | g674 | g674.t37 | exon | g674.t37.exon2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t37 | cds | g674.t37.CDS2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t37 | exon | g674.t37.exon3 | 5210295 | 5211057 |
| chr_3 | g674 | g674.t37 | cds | g674.t37.CDS3 | 5210295 | 5210986 |
| chr_3 | g674 | g674.t37 | exon | g674.t37.exon4 | 5211139 | 5211200 |
| chr_3 | g674 | g674.t37 | TSS | g674.t37 | 5211298 | 5211298 |
Sequences
>g674.t37 Gene=g674 Length=1101
ATGGAGATAATTGACAGCTTATGGAAAATAGAAATCGATTTAATTATTAAAATTCAAAAC
AAAATTTCTCGGATATTTTTCAACATTTTTTGGTTCGGGATATCTCCACTTGTACATTAT
TCCATTGTTTGCAATGTACAACACAAAAGTTTATCATCGTTTATTGATTTCATGCATTGC
GACTGATTTTATTAATCTCATTATAAAATGGATTTTAGATGAAGATCGACCTTACTGGTG
GGTCAATGAAACAAAAGCTTACACATCACTCACCCGACCAATATTATATCAAACTGAAAG
AACTTGTGAGACATCGGGTGGATCACCATCAGGTCATTCGATGATTGCTGCATGTTTTCT
ATACATCATCTATGACGAAATCAACCGACAAATCGACAATCGTCCTTCAATGTCGCACAA
AGTCATACTGAAAATTCTAAACAAAATTGGACTGACTTTTATACTTACAATTACTGCCAT
ATCGAGAATGTACTTTGCTGCACATTTTTTGCATCAATGTATTTTAGGTTTCATGCTTGG
ACTTTTAGTAGCAAATTTAATGGCAAATCATGGATTGGCTGAAAAATTTTCGAGTTTTGA
AAAACGAACTTGGATGACAATAATTGCTTGGATGATAATTTTGGTAGTGTCAATTTATTG
GGCCCATAAATTAATTAGTGGAAATCCAATGAAAACAGTAGAATTGGCATTCAAACATTG
CAAAGATCCACTCTATCCTAAGCCTGAAACTACTGTCGTTTTTTCTGCTCTCCGATGCAT
TGCGATGTCTTGTGGAATTTTGTTAAATGCACCAATTTACAAAAGAGAGTCAAAATTGAA
ATTCTTTGAATCAGCAGTAATGACAATATGTTTAATTATTCTTCAATTCTGTGCAATTTA
TGAAACACCAAAGAATTACAAAATTATCATTTTCTATAGTTATTCATTTATTATTTATGC
ATTTTTCCAATTTATGTTCATCTATTTTGTTCCAAAAATTGCAACAATAACTAATGAAAA
TTCTCAAGAAAAAGTCAAAAATCATTAAATGTTTAACGTATTTATAGAAAAATTCAAATA
AAACCATATAAATGTTAAAAA
>g674.t37 Gene=g674 Length=304
MYNTKVYHRLLISCIATDFINLIIKWILDEDRPYWWVNETKAYTSLTRPILYQTERTCET
SGGSPSGHSMIAACFLYIIYDEINRQIDNRPSMSHKVILKILNKIGLTFILTITAISRMY
FAAHFLHQCILGFMLGLLVANLMANHGLAEKFSSFEKRTWMTIIAWMIILVVSIYWAHKL
ISGNPMKTVELAFKHCKDPLYPKPETTVVFSALRCIAMSCGILLNAPIYKRESKLKFFES
AVMTICLIILQFCAIYETPKNYKIIIFYSYSFIIYAFFQFMFIYFVPKIATITNENSQEK
VKNH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g674.t37 | Gene3D | G3DSA:1.20.144.10 | - | 3 | 159 | 4.1E-13 |
| 2 | g674.t37 | PANTHER | PTHR12591 | GLUCOSE-6-PHOSPHATASE | 3 | 300 | 7.3E-60 |
| 22 | g674.t37 | PIRSF | PIRSF000905 | G6Pase | 2 | 302 | 5.1E-48 |
| 1 | g674.t37 | Pfam | PF01569 | PAP2 superfamily | 10 | 144 | 1.2E-20 |
| 5 | g674.t37 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 6 | - |
| 17 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 28 | - |
| 10 | g674.t37 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 29 | 61 | - |
| 20 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 62 | 80 | - |
| 7 | g674.t37 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 81 | 100 | - |
| 21 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 101 | 119 | - |
| 13 | g674.t37 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 120 | 124 | - |
| 16 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 125 | 148 | - |
| 8 | g674.t37 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 149 | 159 | - |
| 18 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 160 | 178 | - |
| 12 | g674.t37 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 179 | 207 | - |
| 14 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 208 | 229 | - |
| 9 | g674.t37 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 230 | 240 | - |
| 19 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 241 | 259 | - |
| 11 | g674.t37 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 260 | 264 | - |
| 15 | g674.t37 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 265 | 286 | - |
| 6 | g674.t37 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 287 | 304 | - |
| 27 | g674.t37 | SMART | SM00014 | acid_phosph_2 | 5 | 144 | 2.6E-15 |
| 3 | g674.t37 | SUPERFAMILY | SSF48317 | Acid phosphatase/Vanadium-dependent haloperoxidase | 8 | 143 | 4.45E-13 |
| 24 | g674.t37 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 122 | 144 | - |
| 23 | g674.t37 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 159 | 178 | - |
| 26 | g674.t37 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 237 | 259 | - |
| 25 | g674.t37 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 264 | 286 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0004346 | glucose-6-phosphatase activity | MF |
KEGG
Orthology
- This transcript has been annotated with K01084 (glucose-6-phosphatase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed