| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g674 | g674.t4 | TTS | g674.t4 | 5209165 | 5209165 |
| chr_3 | g674 | g674.t4 | isoform | g674.t4 | 5209193 | 5210599 |
| chr_3 | g674 | g674.t4 | exon | g674.t4.exon1 | 5209193 | 5209249 |
| chr_3 | g674 | g674.t4 | cds | g674.t4.CDS1 | 5209246 | 5209249 |
| chr_3 | g674 | g674.t4 | exon | g674.t4.exon2 | 5210021 | 5210230 |
| chr_3 | g674 | g674.t4 | cds | g674.t4.CDS2 | 5210021 | 5210230 |
| chr_3 | g674 | g674.t4 | exon | g674.t4.exon3 | 5210295 | 5210599 |
| chr_3 | g674 | g674.t4 | cds | g674.t4.CDS3 | 5210295 | 5210587 |
| chr_3 | g674 | g674.t4 | TSS | g674.t4 | 5211298 | 5211298 |
>g674.t4 Gene=g674 Length=572
ATTTTAGGTTTCATGCTTGGACTTTTAGTAGCAAATTTAATGGCAAATCATGGATTGGCT
GAAAAATTTTCGAGTTTTGAAAAACGAACTTGGATGACAATAATTGCTTGGATGATAATT
TTGGTAGTGTCAATTTATTGGGCCCATAAATTAATTAGTGGAAATCCAATGAAAACAGTA
GAATTGGCATTCAAACATTGCAAAGATCCACTCTATCCTAAGCCTGAAACTACTGTCGTT
TTTTCTGCTCTCCGATGCATTGCGATGTCTTGTGGAATTTTGTTAAATGCACCAATTTAC
AAAAGATTGAAATTCTTTGAATCAGCAGTAATGACAATATGTTTAATTATTCTTCAATTC
TGTGCAATTTATGAAACACCAAAGAATTACAAAATTATCATTTTCTATAGTTATTCATTT
ATTATTTATGCATTTTTCCAATTTATGTTCATCTATTTTGTTCCAAAAATTGCAACAATA
ACTAATGAAAATTCTCAAGAAAAAGTCAAAAATCATTAAATGTTTAACGTATTTATAGAA
AAATTCAAATAAAACCATATAAATGTTAAAAA
>g674.t4 Gene=g674 Length=168
MLGLLVANLMANHGLAEKFSSFEKRTWMTIIAWMIILVVSIYWAHKLISGNPMKTVELAF
KHCKDPLYPKPETTVVFSALRCIAMSCGILLNAPIYKRLKFFESAVMTICLIILQFCAIY
ETPKNYKIIIFYSYSFIIYAFFQFMFIYFVPKIATITNENSQEKVKNH
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g674.t4 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 16 | - |
| 11 | g674.t4 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 1 | - |
| 12 | g674.t4 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 2 | 9 | - |
| 17 | g674.t4 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 10 | 16 | - |
| 9 | g674.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 17 | 25 | - |
| 15 | g674.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 26 | 44 | - |
| 6 | g674.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 45 | 73 | - |
| 13 | g674.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 95 | - |
| 8 | g674.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 96 | 100 | - |
| 16 | g674.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 101 | 120 | - |
| 5 | g674.t4 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 121 | 128 | - |
| 14 | g674.t4 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 129 | 150 | - |
| 7 | g674.t4 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 151 | 168 | - |
| 3 | g674.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 27 | 44 | - |
| 1 | g674.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 96 | - |
| 4 | g674.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 101 | 123 | - |
| 2 | g674.t4 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 128 | 150 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed