| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_3 | g674 | g674.t6 | TTS | g674.t6 | 5209165 | 5209165 |
| chr_3 | g674 | g674.t6 | isoform | g674.t6 | 5209193 | 5210901 |
| chr_3 | g674 | g674.t6 | exon | g674.t6.exon1 | 5209193 | 5209252 |
| chr_3 | g674 | g674.t6 | cds | g674.t6.CDS1 | 5209246 | 5209252 |
| chr_3 | g674 | g674.t6 | exon | g674.t6.exon2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t6 | cds | g674.t6.CDS2 | 5210021 | 5210239 |
| chr_3 | g674 | g674.t6 | exon | g674.t6.exon3 | 5210295 | 5210901 |
| chr_3 | g674 | g674.t6 | cds | g674.t6.CDS3 | 5210295 | 5210779 |
| chr_3 | g674 | g674.t6 | TSS | g674.t6 | 5211298 | 5211298 |
>g674.t6 Gene=g674 Length=886
ATGAAGATCGACCTTACTGGTGGGTCAATGAAACAAAAGCTTACACATCACTCACCCGAC
CAATATTATATCAAACTGAAAGAACTTGTGAGACATCGGGTGGATCACCATCAGGTCATT
CGATGATTGCTGCATGTTTTCTATACATCATCTATGACGAAATCAACCGACAAATCGACA
ATCGTCCTTCAATGTCGCACAAAGTCATACTGAAAATTCTAAACAAAATTGGACTGACTT
TTATACTTACAATTACTGCCATATCGAGAATGTACTTTGCTGCACATTTTTTGCATCAAT
GTATTTTAGGTTTCATGCTTGGACTTTTAGTAGCAAATTTAATGGCAAATCATGGATTGG
CTGAAAAATTTTCGAGTTTTGAAAAACGAACTTGGATGACAATAATTGCTTGGATGATAA
TTTTGGTAGTGTCAATTTATTGGGCCCATAAATTAATTAGTGGAAATCCAATGAAAACAG
TAGAATTGGCATTCAAACATTGCAAAGATCCACTCTATCCTAAGCCTGAAACTACTGTCG
TTTTTTCTGCTCTCCGATGCATTGCGATGTCTTGTGGAATTTTGTTAAATGCACCAATTT
ACAAAAGAGAGTCAAAATTGAAATTCTTTGAATCAGCAGTAATGACAATATGTTTAATTA
TTCTTCAATTCTGTGCAATTTATGAAACACCAAAGAATTACAAAATTATCATTTTCTATA
GTTATTCATTTATTATTTATGCATTTTTCCAATTTATGTTCATCTATTTTGTTCCAAAAA
TTGCAACAATAACTAATGAAAATTCTCAAGAAAAAGTCAAAAATCATAATTAAATGTTTA
ACGTATTTATAGAAAAATTCAAATAAAACCATATAAATGTTAAAAA
>g674.t6 Gene=g674 Length=236
MIAACFLYIIYDEINRQIDNRPSMSHKVILKILNKIGLTFILTITAISRMYFAAHFLHQC
ILGFMLGLLVANLMANHGLAEKFSSFEKRTWMTIIAWMIILVVSIYWAHKLISGNPMKTV
ELAFKHCKDPLYPKPETTVVFSALRCIAMSCGILLNAPIYKRESKLKFFESAVMTICLII
LQFCAIYETPKNYKIIIFYSYSFIIYAFFQFMFIYFVPKIATITNENSQEKVKNHN
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g674.t6 | Gene3D | G3DSA:1.20.144.10 | - | 1 | 90 | 1.7E-5 |
| 2 | g674.t6 | PANTHER | PTHR12591 | GLUCOSE-6-PHOSPHATASE | 1 | 231 | 7.9E-29 |
| 1 | g674.t6 | Pfam | PF01569 | PAP2 superfamily | 3 | 75 | 7.5E-8 |
| 10 | g674.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 31 | - |
| 20 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 32 | 50 | - |
| 14 | g674.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 51 | 55 | - |
| 15 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 56 | 79 | - |
| 9 | g674.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 80 | 90 | - |
| 18 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 91 | 109 | - |
| 13 | g674.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 110 | 138 | - |
| 16 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 139 | 160 | - |
| 8 | g674.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 161 | 171 | - |
| 17 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 172 | 190 | - |
| 12 | g674.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 191 | 195 | - |
| 19 | g674.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 196 | 217 | - |
| 11 | g674.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 218 | 236 | - |
| 6 | g674.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 53 | 75 | - |
| 4 | g674.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 90 | 109 | - |
| 5 | g674.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 168 | 190 | - |
| 3 | g674.t6 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 195 | 217 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed