General information for g6767.t5
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Aly/REF export factor 2.
Parent gene
- The parent gene g6767 is located on chr_2: 18541523..18543877 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6767 | g6767.t5 | TSS | g6767.t5 | 18539688 | 18539688 |
| chr_2 | g6767 | g6767.t5 | isoform | g6767.t5 | 18539830 | 18541190 |
| chr_2 | g6767 | g6767.t5 | exon | g6767.t5.exon1 | 18539830 | 18540015 |
| chr_2 | g6767 | g6767.t5 | cds | g6767.t5.CDS1 | 18539830 | 18540015 |
| chr_2 | g6767 | g6767.t5 | exon | g6767.t5.exon2 | 18540886 | 18541114 |
| chr_2 | g6767 | g6767.t5 | cds | g6767.t5.CDS2 | 18540886 | 18541114 |
| chr_2 | g6767 | g6767.t5 | exon | g6767.t5.exon3 | 18541186 | 18541190 |
| chr_2 | g6767 | g6767.t5 | cds | g6767.t5.CDS3 | 18541186 | 18541190 |
| chr_2 | g6767 | g6767.t5 | TTS | g6767.t5 | 18541941 | 18541941 |
Sequences
>g6767.t5 Gene=g6767 Length=420
ATGGATAAGATTGAGATGAGTTTAGATGACATCATAAAACAAAACAAAAAGACATCGGGA
AAAAATCGTCGACCAGGCCTTAGTAATAAGAAAACTACTTCTCCGAATAAGACAAAGAAA
TTTGGAAATGGCGGAATTTTGAAAGGCCGTGGTCGTGGTGGAATCGCACGCTCAAAGTAT
ACTCGGGGTGATGTTAACAGCGCATGGAAACACGATATGTATGAAGGTGGACGAAAATTG
GGAGGAGCATTGGCATTATCAACAGGCGGTAATCGTGGAGTAGGAGGAACCACAAAACTC
GTAGTGTCAAATCTGGATTTCAGCGTTTCTGACTCGGATATTAATGAATTGTTCCAAGAA
TTTGGACCTTTAAAAGCTGCATCCGTTCACTATGACCGTTCCGGCAGATCTCTTGGAACA
>g6767.t5 Gene=g6767 Length=140
MDKIEMSLDDIIKQNKKTSGKNRRPGLSNKKTTSPNKTKKFGNGGILKGRGRGGIARSKY
TRGDVNSAWKHDMYEGGRKLGGALALSTGGNRGVGGTTKLVVSNLDFSVSDSDINELFQE
FGPLKAASVHYDRSGRSLGT
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g6767.t5 | Gene3D | G3DSA:3.30.70.330 | - | 86 | 140 | 1.8E-9 |
| 6 | g6767.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 48 | - |
| 8 | g6767.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 17 | - |
| 7 | g6767.t5 | MobiDBLite | mobidb-lite | consensus disorder prediction | 25 | 40 | - |
| 3 | g6767.t5 | PANTHER | PTHR19965 | RNA AND EXPORT FACTOR BINDING PROTEIN | 4 | 140 | 1.1E-21 |
| 4 | g6767.t5 | PANTHER | PTHR19965:SF74 | CHROMATIN TARGET OF PRMT1 PROTEIN-RELATED | 4 | 140 | 1.1E-21 |
| 1 | g6767.t5 | Pfam | PF07078 | Forty-two-three protein | 1 | 54 | 2.8E-5 |
| 2 | g6767.t5 | Pfam | PF00076 | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | 100 | 139 | 8.4E-7 |
| 10 | g6767.t5 | ProSiteProfiles | PS50102 | Eukaryotic RNA Recognition Motif (RRM) profile. | 98 | 140 | 9.644 |
| 5 | g6767.t5 | SUPERFAMILY | SSF54928 | RNA-binding domain, RBD | 92 | 139 | 1.24E-10 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003676 | nucleic acid binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
