General information for g6784.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Aldehyde oxidase 2.
Parent gene
- The parent gene g6784 is located on chr_2: 18594125..18594588 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6784 | g6784.t1 | isoform | g6784.t1 | 18593633 | 18594164 |
| chr_2 | g6784 | g6784.t1 | exon | g6784.t1.exon1 | 18593633 | 18593797 |
| chr_2 | g6784 | g6784.t1 | cds | g6784.t1.CDS1 | 18593633 | 18593797 |
| chr_2 | g6784 | g6784.t1 | exon | g6784.t1.exon2 | 18593860 | 18594035 |
| chr_2 | g6784 | g6784.t1 | cds | g6784.t1.CDS2 | 18593860 | 18594035 |
| chr_2 | g6784 | g6784.t1 | exon | g6784.t1.exon3 | 18594125 | 18594164 |
| chr_2 | g6784 | g6784.t1 | cds | g6784.t1.CDS3 | 18594125 | 18594164 |
| chr_2 | g6784 | g6784.t1 | TSS | g6784.t1 | 18594832 | 18594832 |
| chr_2 | g6784 | g6784.t1 | TTS | g6784.t1 | NA | NA |
Sequences
>g6784.t1 Gene=g6784 Length=381
ATGGAAGCTAATTTTACAATAAATGGAATAGAATTCAAAATAACACCATCAACTATTTCA
ATCGAAACAACTCTTAATGATTTTATTCGTAAACATGCAAAACTTACGGGAACAAAATTT
ATGTGCTTGGAGGGAGGATGTGGTGCATGTATTGTGATGCTAAAAGGTGTTCATCCTGTT
ACAAAGCAAAATACTTCTTGGGCTGTTAAAAATTCTTGTCTTCAAAATATCTATTCATGT
CATGGTCTTGATATCATAACTGTTGAAGGAATTGGTAGCAAAAAAGATGGCATGCATAAA
ATTCAAAAACGATTGGCTGATTTTAATGGAACTCAATGTGGATTTTGCACTCCTGGAATG
GTCATGAATATGTTTCATTGA
>g6784.t1 Gene=g6784 Length=126
MEANFTINGIEFKITPSTISIETTLNDFIRKHAKLTGTKFMCLEGGCGACIVMLKGVHPV
TKQNTSWAVKNSCLQNIYSCHGLDIITVEGIGSKKDGMHKIQKRLADFNGTQCGFCTPGM
VMNMFH
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g6784.t1 | Gene3D | G3DSA:3.30.365.10 | Aldehyde Oxidoreductase; domain 4 | 1 | 126 | 1.9E-51 |
| 3 | g6784.t1 | PANTHER | PTHR11908:SF132 | ALDEHYDE OXIDASE 1-RELATED | 2 | 125 | 3.9E-40 |
| 4 | g6784.t1 | PANTHER | PTHR11908 | XANTHINE DEHYDROGENASE | 2 | 125 | 3.9E-40 |
| 1 | g6784.t1 | Pfam | PF00111 | 2Fe-2S iron-sulfur cluster binding domain | 20 | 56 | 4.6E-5 |
| 2 | g6784.t1 | Pfam | PF01799 | [2Fe-2S] binding domain | 87 | 125 | 6.3E-13 |
| 7 | g6784.t1 | ProSitePatterns | PS00197 | 2Fe-2S ferredoxin-type iron-sulfur binding region signature. | 42 | 50 | - |
| 9 | g6784.t1 | ProSiteProfiles | PS51085 | 2Fe-2S ferredoxin-type iron-sulfur binding domain profile. | 1 | 91 | 8.683 |
| 6 | g6784.t1 | SUPERFAMILY | SSF54292 | 2Fe-2S ferredoxin-like | 1 | 92 | 4.04E-18 |
| 5 | g6784.t1 | SUPERFAMILY | SSF47741 | CO dehydrogenase ISP C-domain like | 99 | 125 | 3.53E-13 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0009055 | electron transfer activity | MF |
| GO:0051537 | 2 iron, 2 sulfur cluster binding | MF |
| GO:0046872 | metal ion binding | MF |
| GO:0055114 | NA | NA |
| GO:0051536 | iron-sulfur cluster binding | MF |
| GO:0016491 | oxidoreductase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
