| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6805 | g6805.t1 | TTS | g6805.t1 | 18831541 | 18831541 |
| chr_2 | g6805 | g6805.t1 | isoform | g6805.t1 | 18831603 | 18831916 |
| chr_2 | g6805 | g6805.t1 | exon | g6805.t1.exon1 | 18831603 | 18831733 |
| chr_2 | g6805 | g6805.t1 | cds | g6805.t1.CDS1 | 18831603 | 18831733 |
| chr_2 | g6805 | g6805.t1 | exon | g6805.t1.exon2 | 18831790 | 18831916 |
| chr_2 | g6805 | g6805.t1 | cds | g6805.t1.CDS2 | 18831790 | 18831916 |
| chr_2 | g6805 | g6805.t1 | TSS | g6805.t1 | NA | NA |
>g6805.t1 Gene=g6805 Length=258
ATGACTGGCCGTGGCAAAGGAGGCAAAGGTTTAGGAAAAGGAGGTGCAAAGCGTCATCGT
AAAGTTCTTCGTGATAAAATCCAAGGTATCACAAAGCCAGCCATTCGTCGTTTGGCTCGT
CGTGGTGTTTTCTTGGAAAATGTCATTCGTGATGCAGTCACATACACTGAACATGCCAAA
CGCAAGACAGTCACAGCTATGGATGTCGTCTATGCCTTGAAACGTCAAGGACGTACTCTC
TATGGTTTTGGAGGATAA
>g6805.t1 Gene=g6805 Length=85
MTGRGKGGKGLGKGGAKRHRKVLRDKIQGITKPAIRRLARRGVFLENVIRDAVTYTEHAK
RKTVTAMDVVYALKRQGRTLYGFGG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g6805.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 42 | 1.4E-16 |
| 9 | g6805.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 43 | 85 | 2.9E-22 |
| 13 | g6805.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 23 | - |
| 3 | g6805.t1 | PANTHER | PTHR10484 | HISTONE H4 | 1 | 42 | 8.7E-46 |
| 5 | g6805.t1 | PANTHER | PTHR10484:SF185 | HISTONE H4 | 1 | 42 | 8.7E-46 |
| 2 | g6805.t1 | PANTHER | PTHR10484 | HISTONE H4 | 43 | 85 | 8.7E-46 |
| 4 | g6805.t1 | PANTHER | PTHR10484:SF185 | HISTONE H4 | 43 | 85 | 8.7E-46 |
| 6 | g6805.t1 | PRINTS | PR00623 | Histone H4 signature | 5 | 16 | 4.3E-19 |
| 7 | g6805.t1 | PRINTS | PR00623 | Histone H4 signature | 20 | 39 | 4.3E-19 |
| 1 | g6805.t1 | Pfam | PF15511 | Centromere kinetochore component CENP-T histone fold | 42 | 78 | 1.5E-7 |
| 11 | g6805.t1 | ProSitePatterns | PS00047 | Histone H4 signature. | 15 | 19 | - |
| 12 | g6805.t1 | SMART | SM00417 | h44 | 16 | 72 | 2.1E-18 |
| 8 | g6805.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 3 | 84 | 7.71E-24 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.