General information for g6806.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g6806 is located on chr_2: 18832320..18832730 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6806 | g6806.t1 | isoform | g6806.t1 | 18832320 | 18832730 |
| chr_2 | g6806 | g6806.t1 | exon | g6806.t1.exon1 | 18832320 | 18832447 |
| chr_2 | g6806 | g6806.t1 | cds | g6806.t1.CDS1 | 18832320 | 18832447 |
| chr_2 | g6806 | g6806.t1 | exon | g6806.t1.exon2 | 18832586 | 18832730 |
| chr_2 | g6806 | g6806.t1 | cds | g6806.t1.CDS2 | 18832586 | 18832730 |
| chr_2 | g6806 | g6806.t1 | TTS | g6806.t1 | 18832775 | 18832775 |
| chr_2 | g6806 | g6806.t1 | TSS | g6806.t1 | NA | NA |
Sequences
>g6806.t1 Gene=g6806 Length=273
ATGGCTCGTACAAAGCAAACTGCTCGTAAATCAACTGGAGGCAAAGCACCTCGTAAGCAA
TTGGCTACAAAGGCTGCTCGTAAATCAGCACCAGCAACTGGAGGAGTAAAAAAAACCACA
TCGTTATCCAGTCATGGCATTGCAAGAAGCATCAGAAGCTTCTTGGTTTGTCTTTTTGAA
GATACAAACTTGTGCGCTATTCATGCCAAGCGTGTCACAATTATGCCAAAGGATATTCAA
CTCGCTCGTCGTATTCGTGGTGAACGCGCTTAA
>g6806.t1 Gene=g6806 Length=90
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKTTSLSSHGIARSIRSFLVCLFE
DTNLCAIHAKRVTIMPKDIQLARRIRGERA
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g6806.t1 | Coils | Coil | Coil | 82 | 90 | - |
| 10 | g6806.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 2 | 50 | 2.6E-10 |
| 9 | g6806.t1 | Gene3D | G3DSA:1.10.20.10 | Histone | 51 | 90 | 1.1E-18 |
| 14 | g6806.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 43 | - |
| 3 | g6806.t1 | PANTHER | PTHR11426 | HISTONE H3 | 1 | 42 | 1.3E-40 |
| 5 | g6806.t1 | PANTHER | PTHR11426:SF194 | HISTONE H3 | 1 | 42 | 1.3E-40 |
| 2 | g6806.t1 | PANTHER | PTHR11426 | HISTONE H3 | 50 | 90 | 1.3E-40 |
| 4 | g6806.t1 | PANTHER | PTHR11426:SF194 | HISTONE H3 | 50 | 90 | 1.3E-40 |
| 6 | g6806.t1 | PRINTS | PR00622 | Histone H3 signature | 3 | 17 | 9.1E-17 |
| 7 | g6806.t1 | PRINTS | PR00622 | Histone H3 signature | 17 | 31 | 9.1E-17 |
| 1 | g6806.t1 | Pfam | PF00125 | Core histone H2A/H2B/H3/H4 | 53 | 86 | 5.5E-14 |
| 12 | g6806.t1 | ProSitePatterns | PS00322 | Histone H3 signature 1. | 15 | 21 | - |
| 13 | g6806.t1 | SMART | SM00428 | h35 | 8 | 90 | 4.8E-12 |
| 8 | g6806.t1 | SUPERFAMILY | SSF47113 | Histone-fold | 2 | 88 | 2.68E-23 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003677 | DNA binding | MF |
| GO:0046982 | protein heterodimerization activity | MF |
| GO:0000786 | nucleosome | CC |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
