Gene loci information

Transcript annotation

  • This transcript has been not been annotated.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_2 g6809 g6809.t1 TTS g6809.t1 18837758 18837758
chr_2 g6809 g6809.t1 isoform g6809.t1 18837811 18838123
chr_2 g6809 g6809.t1 exon g6809.t1.exon1 18837811 18838037
chr_2 g6809 g6809.t1 cds g6809.t1.CDS1 18837811 18838037
chr_2 g6809 g6809.t1 exon g6809.t1.exon2 18838096 18838123
chr_2 g6809 g6809.t1 cds g6809.t1.CDS2 18838096 18838123
chr_2 g6809 g6809.t1 TSS g6809.t1 18838183 18838183

Sequences

>g6809.t1 Gene=g6809 Length=255
ATGACTGGCCGTGGCAAAGGAGGCAAAGGTATCACAAAGCCAGCCATTCGTCGTTTGGCT
CGTCGTGGTGGTGTCAAGCGTATTTCAGGCTTGATCTACGAAGAAACTCGTGGTGTCTTG
AAAGTTTTCTTGGAAAATGTCATTCGTGATGCAGTCACATACACTGAACACGCTAAGCGC
AAGACAGTCACAGCTATGGATGTCGTCTATGCCTTGAAACGTCAAGGACGTACTCTCTAT
GGTTTCGGAGGATAA

>g6809.t1 Gene=g6809 Length=84
MTGRGKGGKGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
12 g6809.t1 CDD cd00076 H4 9 82 0
11 g6809.t1 Gene3D G3DSA:1.10.20.10 Histone 4 84 0
2 g6809.t1 PANTHER PTHR10484 HISTONE H4 9 84 0
3 g6809.t1 PANTHER PTHR10484:SF177 HISTONE H4 9 84 0
4 g6809.t1 PRINTS PR00623 Histone H4 signature 1 20 0
6 g6809.t1 PRINTS PR00623 Histone H4 signature 21 41 0
7 g6809.t1 PRINTS PR00623 Histone H4 signature 43 57 0
8 g6809.t1 PRINTS PR00623 Histone H4 signature 58 70 0
5 g6809.t1 PRINTS PR00623 Histone H4 signature 70 81 0
1 g6809.t1 Pfam PF15511 Centromere kinetochore component CENP-T histone fold 19 77 0
10 g6809.t1 SMART SM00417 h44 9 71 0
9 g6809.t1 SUPERFAMILY SSF47113 Histone-fold 9 83 0

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0003677 DNA binding MF
GO:0046982 protein heterodimerization activity MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values