General information for g6816.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g6816 is located on chr_2: 18880065..18880389 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_2 | g6816 | g6816.t1 | TSS | g6816.t1 | 18879354 | 18879354 |
| chr_2 | g6816 | g6816.t1 | isoform | g6816.t1 | 18880065 | 18880389 |
| chr_2 | g6816 | g6816.t1 | exon | g6816.t1.exon1 | 18880065 | 18880102 |
| chr_2 | g6816 | g6816.t1 | cds | g6816.t1.CDS1 | 18880065 | 18880102 |
| chr_2 | g6816 | g6816.t1 | exon | g6816.t1.exon2 | 18880158 | 18880243 |
| chr_2 | g6816 | g6816.t1 | cds | g6816.t1.CDS2 | 18880158 | 18880243 |
| chr_2 | g6816 | g6816.t1 | exon | g6816.t1.exon3 | 18880304 | 18880389 |
| chr_2 | g6816 | g6816.t1 | cds | g6816.t1.CDS3 | 18880304 | 18880389 |
| chr_2 | g6816 | g6816.t1 | TTS | g6816.t1 | 18880774 | 18880774 |
Sequences
>g6816.t1 Gene=g6816 Length=210
ATGGAAAATTTGAACAAACTCGTACGAAAATCTCATGGTTTAAGATGTCTCGGTGGAGCA
GTTTTAAAATATTGTTATGTTGCATTAGGTGCAGCTGAATGTGCTTATGATTTTGGTGCT
CATGCTTGGGATTATGCTGCAAGTGAATTCATTGTTCGTGAAGCTGGAGGAGTTACAAAG
ATCCATCAGGAGGTATTTTTGATATTATGA
>g6816.t1 Gene=g6816 Length=69
MENLNKLVRKSHGLRCLGGAVLKYCYVALGAAECAYDFGAHAWDYAASEFIVREAGGVTK
IHQEVFLIL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g6816.t1 | Gene3D | G3DSA:3.40.190.80 | - | 1 | 66 | 2.7E-19 |
| 2 | g6816.t1 | PANTHER | PTHR20854 | INOSITOL MONOPHOSPHATASE | 1 | 59 | 5.0E-14 |
| 4 | g6816.t1 | PRINTS | PR00377 | Inositol monophosphatase superfamily signature | 9 | 30 | 1.4E-8 |
| 3 | g6816.t1 | PRINTS | PR00377 | Inositol monophosphatase superfamily signature | 40 | 64 | 1.4E-8 |
| 1 | g6816.t1 | Pfam | PF00459 | Inositol monophosphatase family | 2 | 60 | 7.3E-15 |
| 6 | g6816.t1 | ProSitePatterns | PS00630 | Inositol monophosphatase family signature 2. | 43 | 57 | - |
| 5 | g6816.t1 | SUPERFAMILY | SSF56655 | Carbohydrate phosphatase | 4 | 59 | 3.66E-16 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0046855 | inositol phosphate dephosphorylation | BP |
| GO:0046854 | phosphatidylinositol phosphate biosynthetic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
